Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.0018 64 4.3 1.3 11 16 13 18 11 19 0.82

2 3 4.2e-10 1.5e-05 25.5 2.2 4 21 55 72 53 73 0.87

3 3 0.08 2.8e+03 -1.0 4.1 10 15 84 89 83 91 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.0018	64	4.3	1.3	11	16	13	18	11	19	0.82
2	3	4.2e-10	1.5e-05	25.5	2.2	4	21	55	72	53	73	0.87
3	3	0.08	2.8e+03	-1.0	4.1	10	15	84	89	83	91	0.84

Coding Sequence: ATGTCTGATGATGGTTCAACAGTTGTTGAGAAGAAAAGTAGAGGCCGACCTAAAGCCAATGGAACACAGGCAGAGGCTAAAGTTGACAGTAAGAAAAGAAGCAGGCCACCAGTTAAAGAATCGGTCAGGACTAAAGAATCAACAAAGTCCTCTGATGATGAACAGGCGCCTGTAGCGAAAAGAGGACGAGGTCGACCAAAGGGATCTAAGAAAAAGGCTTCAAAAGCAAAGagTGCACCAGTTGAAGGTAGGGGCCGTGGCCGACCACGTAAGGAACCTGCTCCACCTAAAAAAGATGCAGCTTCTACAGAAGAGGAACAGGATGAGGATGAAGAAGACGAAGGGTCTGAAGACCAGTAA
Protein Sequence: MSDDGSTVVEKKSRGRPKANGTQAEAKVDSKKRSRPPVKESVRTKESTKSSDDEQAPVAKRGRGRPKGSKKKASKAKSAPVEGRGRGRPRKEPAPPKKDAASTEEEQDEDEEDEGSEDQ*

Sequence clustering based on sequence similarity using MMseqs2