Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 1.4 9.3e+02 1.3 0.0 23 52 6 35 4 36 0.82

2 10 0.18 1.2e+02 4.2 0.0 21 52 32 63 28 65 0.87

3 10 2.3 1.5e+03 0.7 0.0 21 50 60 89 53 92 0.84

4 10 0.087 59 5.2 0.0 23 52 90 119 82 121 0.86

5 10 4.2 2.8e+03 -0.2 0.0 22 52 117 147 114 151 0.86

6 10 6.1 4.1e+03 -0.7 0.0 24 48 147 171 140 177 0.80

7 10 0.027 18 6.8 0.1 21 52 200 231 191 237 0.87

8 10 0.89 6.1e+02 2.0 0.0 21 45 256 280 248 287 0.85

9 10 0.00045 0.3 12.5 0.2 21 48 284 311 278 316 0.83

10 10 1.9 1.3e+03 0.9 0.0 22 43 313 334 309 338 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	1.4	9.3e+02	1.3	0.0	23	52	6	35	4	36	0.82
2	10	0.18	1.2e+02	4.2	0.0	21	52	32	63	28	65	0.87
3	10	2.3	1.5e+03	0.7	0.0	21	50	60	89	53	92	0.84
4	10	0.087	59	5.2	0.0	23	52	90	119	82	121	0.86
5	10	4.2	2.8e+03	-0.2	0.0	22	52	117	147	114	151	0.86
6	10	6.1	4.1e+03	-0.7	0.0	24	48	147	171	140	177	0.80
7	10	0.027	18	6.8	0.1	21	52	200	231	191	237	0.87
8	10	0.89	6.1e+02	2.0	0.0	21	45	256	280	248	287	0.85
9	10	0.00045	0.3	12.5	0.2	21	48	284	311	278	316	0.83
10	10	1.9	1.3e+03	0.9	0.0	22	43	313	334	309	338	0.88

Coding Sequence: ATGTTTACTGGTGGGAAAccttacaaatgtgttgaatgtgataaaacattctctgAATCCTCAAAGTTAATTAGGCActtgaggattcacactggagagaaaccatacaaatgtgttgaatgtgatcgGACATTTTCAGAATCCTCGAACTTAACAaagcacatgaggattcacactggtgaaaaaccatacaaatgtgttgagtgtggtcAAACATTCTCGCGGTCCTCAAACTTCACAACACACATGAGGGTCCACACTGGTGCAACACCTTTCAAATGTGTTGTATGTGATAAAACTTTCTCACAATCCTCAGACTTAACAaagcacatgagaattcacactggtgagaaaccatacaaatgtgttgactGTGATAAGACATTCTCACGATCCTCACACTTAACAATGCACATGAAGATCCACACTGGtgtaaaaccatttaaatgtgttgaatgtgataaagcaTACTCAGAATCCTCAAGACTAAAAAAGCACATGAAAATTCATattggtgaaaaaccatacaaatgtgtcgagtgtaaCCAgacattttcagaattctcaAGAATAAAAAACCACATGAGAGTTCACACTGgcgaaaaaccatacaaatgtgatgAATGCGATAAAGCATTCTCTCAGTCCTCAAACTTAACCACGCATATGAGGATccacacaggtgaaaaaccattcaaatgtcTTGTATGTGATAAAAGATTCACACTATTCTCATTATTAACAAAGCACAtaaggactcacactggtgagaaaccattcaaatgcATTCAGTGTGATAAATCGTTCTCAGAGTCGTCGAAATTAACAAGGCACATGAGGagtcacactggtgaaaaaccattcaaatgtgttgaatgttatAATACATTCTCCGATTCCTCGTGCTTAAGAaggcacatgagaattcacggcggtgaaaaaccttacaaATGTGTTCAATGTAATGAAACATTCTCGCAGagcacaaaattaaatgaacataaaatgattcacttgtga
Protein Sequence: MFTGGKPYKCVECDKTFSESSKLIRHLRIHTGEKPYKCVECDRTFSESSNLTKHMRIHTGEKPYKCVECGQTFSRSSNFTTHMRVHTGATPFKCVVCDKTFSQSSDLTKHMRIHTGEKPYKCVDCDKTFSRSSHLTMHMKIHTGVKPFKCVECDKAYSESSRLKKHMKIHIGEKPYKCVECNQTFSEFSRIKNHMRVHTGEKPYKCDECDKAFSQSSNLTTHMRIHTGEKPFKCLVCDKRFTLFSLLTKHIRTHTGEKPFKCIQCDKSFSESSKLTRHMRSHTGEKPFKCVECYNTFSDSSCLRRHMRIHGGEKPYKCVQCNETFSQSTKLNEHKMIHL

Sequence clustering based on sequence similarity using MMseqs2