Eocu000255.1
Basic Information
- Insect
- Eucriotettix oculatus
- Gene Symbol
- -
- Assembly
- GCA_034510155.1
- Location
- CM067376.1:2375475-2376164[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.0036 2.4 9.6 0.0 21 47 5 31 2 36 0.86 2 7 0.0065 4.4 8.8 0.0 21 46 33 58 31 64 0.87 3 7 0.033 22 6.5 0.0 21 51 61 91 57 94 0.86 4 7 0.79 5.4e+02 2.1 0.1 21 44 117 140 109 145 0.77 5 7 0.079 53 5.3 0.0 21 46 145 170 138 176 0.83 6 7 0.11 74 4.9 0.1 22 44 174 196 169 199 0.89 7 7 0.012 8.3 7.9 0.0 21 48 201 228 196 229 0.85
Sequence Information
- Coding Sequence
- atgactcacactggtgagaaaccatacaaatgtgctgtgtgtgataaaacatttgcgGAATCCTCAAACTTAATAAGGCACATGATGATTCActctggtgagaaaccatacatttgtgttgaatgtgataaagtaTTCAGACTATCCTCAGACTTGACAAGACATatgagaactcacactggtgaaaaaccatacaaatgtgccgAGTGTGATAAAATGTTTGCACAATCATCAAACTTAATTGGGCACATGGGAATTCACACTGgcgagaaaccatacaaatgtgtagaaTGTAGCAAAGAATTCTCACTATCTGCACATTTGACACATCATATGAGAACCCACTCTGGTGAaagaccatacaaatgtgttgaatgttatAAAGCATTCTCATTAGCCTCGCACTTGGTGAAACACATGAGAACCCACACTGAGGAACGACCATTcaagtgtgttgagtgtgattATACATTCTCGCAATCCTCAAATTTAGCAACCCACATGAGAACCCATACTGGTgacaaaccttacaaatgtgtcgagtgcGGTAAAACATTTGCACAATCCTCAAACTTGGTAAGGCACACAAGAagtcacactggtgagaaaccatataaatgtgccaagtgtgataaaatattctcaacaTCCACAAAGTTAAAAAGACACATCACGCGAACTCACTTGTGA
- Protein Sequence
- MTHTGEKPYKCAVCDKTFAESSNLIRHMMIHSGEKPYICVECDKVFRLSSDLTRHMRTHTGEKPYKCAECDKMFAQSSNLIGHMGIHTGEKPYKCVECSKEFSLSAHLTHHMRTHSGERPYKCVECYKAFSLASHLVKHMRTHTEERPFKCVECDYTFSQSSNLATHMRTHTGDKPYKCVECGKTFAQSSNLVRHTRSHTGEKPYKCAKCDKIFSTSTKLKRHITRTHL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00678636; iTF_00678841;
- 90% Identity
- iTF_00678636; iTF_00678841;
- 80% Identity
- iTF_00678636; iTF_00678841;