Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.1 8.9e+03 -1.3 2.1 12 15 42 45 41 46 0.93

2 3 1.7e-10 1.4e-05 26.8 1.9 4 21 62 79 60 80 0.90

3 3 0.69 6e+04 -4.0 6.9 10 15 92 97 91 98 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.1	8.9e+03	-1.3	2.1	12	15	42	45	41	46	0.93
2	3	1.7e-10	1.4e-05	26.8	1.9	4	21	62	79	60	80	0.90
3	3	0.69	6e+04	-4.0	6.9	10	15	92	97	91	98	0.83

Coding Sequence: ATGAATGAACTGCCGCACCCGCCGTCGGCGTCGCCCCGCCGCCACGCCGTACCCGACGAGGCGGGCGCTAGCGGTTCGGGGCGCGGCGCGGTGTCGAACGAGGCTAAAGGTGATACCAAGAAAAGAGGCAGACCACCAGCACCCATCAGGACCAAGGAATCTGCTAAATCATCTGATGATGAACAGGCGCCGGCAGCGAAAAGAGGTCGAGGCAGGCCCAAGGGATCCAAGAAAAAGGCAGCTGCTAAAGGAAAGAGTGCACCAGTTGAAGGAAGAGGACGTGGTCGACCGCGTAAAGATGCACCACCAAAAAAAGATGCTGCCTCCACTGAAGAGGAACAAGACGAAGATGATGAGGACGAGGGTTCCGAAGAACAGTAA
Protein Sequence: MNELPHPPSASPRRHAVPDEAGASGSGRGAVSNEAKGDTKKRGRPPAPIRTKESAKSSDDEQAPAAKRGRGRPKGSKKKAAAKGKSAPVEGRGRGRPRKDAPPKKDAASTEEEQDEDDEDEGSEEQ

Sequence clustering based on sequence similarity using MMseqs2