Basic Information

Transcription Factor Domain

TF Family: Fork_head
Domain: Fork_head domain
PFAM: PF00250
TF Group: Helix-turn-helix
Description: The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 4.5e-15 5.3e-12 46.1 0.3 4 49 101 150 99 157 0.89

2 2 0.06 71 4.1 0.0 19 35 149 165 145 171 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	4.5e-15	5.3e-12	46.1	0.3	4	49	101	150	99	157	0.89
2	2	0.06	71	4.1	0.0	19	35	149	165	145	171	0.83

Coding Sequence: ATGTCTATTCCGGGGGGCGGTGGTTATCAGAGCCCGTGGTCCTCGCAGACGGGTCTGGCTGAACTGGATGGTACGATGGGAGAGCTGGAGCCTGTGGGCGAACTGACGGAGGTTGGGTTCGAGCCGCAGACGCGAGCACGCTCTAATACGTGGCCGCTACCAAGACCCGACAACTACGTCGACCCAACAGAAGACACCGGCTCCAAGAAGAATTCCAACCAGAATCTAACTGGTGCCCCGCCACTTCCCACTTCTGGAGTTGCCACAAAGAAAAACTCGTCCCGTCGGAACGCTTGGGGCAACCTTTCTTACGCTGATCTCATAACCCAGGCCATCACCTCTGCCCAGGACAACAGGCTCACGTTGTCCCAGATATACGAGTGGATGGTCCAGAACGTGCCATATTTTAAGGATAAGGGGGATAGCAATTCCTCTGCTGGATGGAAGAACAACAGGCTCACGTTGTCCCAAATATACCATCTACTCGGGTCCAGAACGATGAGGATAAGGTTCATAGCGAGTCCTCTTCTGGATAGAAGATAA
Protein Sequence: MSIPGGGGYQSPWSSQTGLAELDGTMGELEPVGELTEVGFEPQTRARSNTWPLPRPDNYVDPTEDTGSKKNSNQNLTGAPPLPTSGVATKKNSSRRNAWGNLSYADLITQAITSAQDNRLTLSQIYEWMVQNVPYFKDKGDSNSSAGWKNNRLTLSQIYHLLGSRTMRIRFIASPLLDRR

Sequence clustering based on sequence similarity using MMseqs2