Este001032.1
Basic Information
- Insect
- Empis stercorea
- Gene Symbol
- Aef1_2
- Assembly
- GCA_949752835.1
- Location
- OX457085.1:12906315-12907092[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.01 1.1e+02 3.8 0.0 22 48 108 134 100 138 0.85 2 4 5.4e-06 0.057 14.3 0.2 21 51 135 165 132 166 0.88 3 4 0.0043 45 5.1 0.0 21 51 163 193 161 194 0.87 4 4 0.00011 1.2 10.2 0.1 21 47 191 217 188 222 0.89
Sequence Information
- Coding Sequence
- ATGACTAATTGTGAGATATTAATTGTTACCACAAGTGATGGTAACCGTTCACATATTCAAATACCTGTATCACGAACAATACCATTACCATCATCAGTAACACCACGTTCAATAATATCTTcagttataaataataataatttagtaaatgCAGCAGCTGTTGCTGCTGCTGCAACATCAACACAATCAAACacaattaataacaataatcatAATTCCTCATTAAATGAAAATCCAACAAATAATACTATACATATGCCAACTGAAATGATTATAAATAGTAGAACAGCTAGAACATCGAATGGTAGTGGTGGTACATTAGATAAACCATTTCAATGTAATGTATGTGAAAGAAAATTTCGACAGCTGAGTACATTAACGAATCATGTAAAAATACATACTGGTGAAAAACCATATAAATGTTCAATATGTGAAAAATGTTTTAGACAGTCAAGTACATTaacaaatcatttaaaaattcatactGGTGAGAAACCATTTGGCTGTACATATTGCGGTAAACAATttcgcCAACTGAGCACTCTaacaaatcatttaaaaattcatactGGTGAAAAACCATTTGAATGTGCTGTTTGTAAAAAACAATTTCGTCAATCAAGCACtttaaataatcatataaaaattcatgttATGGATAAACTTTATATACCATTTGAGattaaagaagaagaagaaggcTGA
- Protein Sequence
- MTNCEILIVTTSDGNRSHIQIPVSRTIPLPSSVTPRSIISSVINNNNLVNAAAVAAAATSTQSNTINNNNHNSSLNENPTNNTIHMPTEMIINSRTARTSNGSGGTLDKPFQCNVCERKFRQLSTLTNHVKIHTGEKPYKCSICEKCFRQSSTLTNHLKIHTGEKPFGCTYCGKQFRQLSTLTNHLKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKLYIPFEIKEEEEG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00643738;
- 90% Identity
- iTF_00643738;
- 80% Identity
- iTF_00644508;