Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.72 2.7e+03 -1.7 0.0 19 23 26 30 12 34 0.64

2 5 0.0052 20 5.2 0.1 22 48 81 107 73 111 0.86

3 5 1.7e-05 0.066 13.1 0.0 21 52 108 139 105 141 0.89

4 5 0.021 80 3.3 0.1 21 48 136 163 134 167 0.85

5 5 6.1e-05 0.23 11.4 0.1 21 47 164 190 162 197 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.72	2.7e+03	-1.7	0.0	19	23	26	30	12	34	0.64
2	5	0.0052	20	5.2	0.1	22	48	81	107	73	111	0.86
3	5	1.7e-05	0.066	13.1	0.0	21	52	108	139	105	141	0.89
4	5	0.021	80	3.3	0.1	21	48	136	163	134	167	0.85
5	5	6.1e-05	0.23	11.4	0.1	21	47	164	190	162	197	0.88

Coding Sequence: ATGATGCATATCAAGAGCCTGCCCCATGCCCATGCCGCTGCCACGGCGATGAGCAGCAACTGCGACATCGTCATTTCGCAGTCGTCGCAGCCACCGCACCTGGTGCATCTGACGGCGCACAGTCCGACCATGTCCAGCGATCACTATCTGGGCACCAATGGGCATGGCGAGCATCCCGGCGAGGGTGGGCCTGGAAGCAATAGCAATGCCGGCGGAGGCGGAGGAGGACCCCGGGAGCTGGAGAAACCCTTCCACTGTACCGTGTGCGATCGTCGCTTCCGGCAGCTGAGCACACTGACCAACCACGTGAAGATCCACACTGGCGAGAAGCCCTACAAATGCAACGTTTGTGATAAGACCTTCCGTCAATCGTCGACGCTGACGAACCATCTGAAGATCCATACGGGCGAGAAGCCCTATAACTGCAACTACTGTCCCAAGCATTTCCGTCAGCTGAGCACCCTGGCCAACCACGTCAAGATCCACACGGGTGAAAAGCCCTTCGAGTGCGTCATCTGCAAGAAACAGTTCCGCCAGTCCAGCACGCTCAACAACCACATAAAGATCCATGTGATGGACAAGGTCTACGTTCCTGTCAAGATCAAAACGGAGGAGGAGGAGGGGTGA
Protein Sequence: MMHIKSLPHAHAAATAMSSNCDIVISQSSQPPHLVHLTAHSPTMSSDHYLGTNGHGEHPGEGGPGSNSNAGGGGGGPRELEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNYCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDKVYVPVKIKTEEEEG

Sequence clustering based on sequence similarity using MMseqs2