Druf013398.1
Basic Information
- Insect
- Drosophila rufa
- Gene Symbol
- Aef1
- Assembly
- GCA_018153105.1
- Location
- JAECXS010000085.1:9002937-9004044[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.72 2.7e+03 -1.7 0.0 19 23 26 30 12 34 0.64 2 5 0.0052 20 5.2 0.1 22 48 81 107 73 111 0.86 3 5 1.7e-05 0.066 13.1 0.0 21 52 108 139 105 141 0.89 4 5 0.021 80 3.3 0.1 21 48 136 163 134 167 0.85 5 5 6.1e-05 0.23 11.4 0.1 21 47 164 190 162 197 0.88
Sequence Information
- Coding Sequence
- ATGATGCATATCAAGAGCCTGCCCCATGCCCATGCCGCTGCCACGGCGATGAGCAGCAACTGCGACATCGTCATTTCGCAGTCGTCGCAGCCACCGCACCTGGTGCATCTGACGGCGCACAGTCCGACCATGTCCAGCGATCACTATCTGGGCACCAATGGGCATGGCGAGCATCCCGGCGAGGGTGGGCCTGGAAGCAATAGCAATGCCGGCGGAGGCGGAGGAGGACCCCGGGAGCTGGAGAAACCCTTCCACTGTACCGTGTGCGATCGTCGCTTCCGGCAGCTGAGCACACTGACCAACCACGTGAAGATCCACACTGGCGAGAAGCCCTACAAATGCAACGTTTGTGATAAGACCTTCCGTCAATCGTCGACGCTGACGAACCATCTGAAGATCCATACGGGCGAGAAGCCCTATAACTGCAACTACTGTCCCAAGCATTTCCGTCAGCTGAGCACCCTGGCCAACCACGTCAAGATCCACACGGGTGAAAAGCCCTTCGAGTGCGTCATCTGCAAGAAACAGTTCCGCCAGTCCAGCACGCTCAACAACCACATAAAGATCCATGTGATGGACAAGGTCTACGTTCCTGTCAAGATCAAAACGGAGGAGGAGGAGGGGTGA
- Protein Sequence
- MMHIKSLPHAHAAATAMSSNCDIVISQSSQPPHLVHLTAHSPTMSSDHYLGTNGHGEHPGEGGPGSNSNAGGGGGGPRELEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNYCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDKVYVPVKIKTEEEEG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00492618;
- 90% Identity
- iTF_00488881;
- 80% Identity
- iTF_00590458;