Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0032 30 4.9 0.1 22 48 97 123 93 127 0.86

2 4 9.6e-06 0.091 13.0 0.0 21 52 124 155 121 157 0.89

3 4 0.012 1.1e+02 3.1 0.1 21 48 152 179 150 183 0.85

4 4 3.1e-05 0.29 11.3 0.1 21 47 180 206 176 213 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0032	30	4.9	0.1	22	48	97	123	93	127	0.86
2	4	9.6e-06	0.091	13.0	0.0	21	52	124	155	121	157	0.89
3	4	0.012	1.1e+02	3.1	0.1	21	48	152	179	150	183	0.85
4	4	3.1e-05	0.29	11.3	0.1	21	47	180	206	176	213	0.88

Coding Sequence: ATGATGCATATCAAGAGCCTGCCCCATGCCCATGCCGCTGCCACGGCGATGAGCAGTAACTGCGACATTGTCATTGTGACCACCCAGCCCCAAACTACCATTgctaacaataataacaatgatACGGCCACGCACCTGGCGCATCTGACCTCGCATAGTCCGCCGATGTCCAGCGATCATTATCTGAGTACCAACGGGCATGGTGAACATCCCGGCGAGGGTGGTGGTGGCCCTGATAGCAATGGCAATgccggcggcggaggcggaggcggaggagcccGCGAGCTGGAGAAACCCTTCCACTGTACCGTGTGCGACCGTCGCTTCCGGCAGCTGAGCACACTGACCAACCACGTGAAGATCCACACTGGCGAGAAGCCCTACAAATGCAACGTTTGTGATAAGACCTTCCGTCAATCGTCGACGCTGACGAACCATCTGAAGATCCATACGGGCGAGAAGCCCTACAACTGCAACTACTGTCCTAAGCATTTCCGTCAGCTGAGCACTCTGGCCAACCACGTGAAGATCCACACGGGTGAAAAGCCCTTCGAGTGCGTCATTTGCAAGAAGCAGTTCCGTCAGTCCAGCACGCTCAACAACCACATAAAGATCCATGTGATGGACAAGGTCTACGTTCCTGTCAAGATCaaaacggaggaggaggaggggtgA
Protein Sequence: MMHIKSLPHAHAAATAMSSNCDIVIVTTQPQTTIANNNNNDTATHLAHLTSHSPPMSSDHYLSTNGHGEHPGEGGGGPDSNGNAGGGGGGGGARELEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNYCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDKVYVPVKIKTEEEEG

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00492454; iTF_00613848; iTF_00613710; iTF_00590458; iTF_00590613;
90% Identity: iTF_00492454; iTF_00613848; iTF_00613710;
80% Identity: iTF_00492454;