Dpau007245.1
Basic Information
- Insect
- Drosophila paulistorum
- Gene Symbol
- -
- Assembly
- GCA_018152135.1
- Location
- JAECXG010000822.1:30874759-30877376[-]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 7.3 8.8e+03 -3.0 0.5 58 65 12 19 8 24 0.55 2 3 2e-15 2.4e-12 46.9 15.2 5 69 145 209 141 210 0.96 3 3 1.1 1.3e+03 -0.3 1.2 4 13 230 239 221 244 0.68
Sequence Information
- Coding Sequence
- ATGTCGGAAGTGCCGTGCGATGTGCAATTTGTGCGTTGCTTGAAGTGTCTCAAGGTGATTAAGTGCTCACGCTATGATACCAACGGATTGGTGGAGCATGTCGCTCAGGATCATCCGGAAATTATGGAACAAGCGAACGAGAAGATCAAAAATCTATATAAATTAGCTGCCGAACATGGCATTAGTCAGGAAAGGCTATCCCAGATTAGCAAAAAGACTGGCATGTCCGAAGAGCGATTGGCCGATGAGGCAGAAAAATATATGGCCAAGAAGAAGAAAAGTGGAAGCAACTTATCGATTGTAGCTTCTGGTCAGAATGTTGCCGAAGGATTGGCCTTTAGGCCCAATCGTGCCAAGGCCTGCGATTCGAGAGATCTCAGTCGTCGTCAATATTATCGCGCTTCCATTGAACGTTGGAACGCCACAGATGGGGCCATCTATTGCCCTTCTTGCGGCTGCTGTCGTCGCCCAGTGATCCAGACAAAAACGGAATTTTACAAGAGCACAGGATGTTGTGCTGCCTGTTTGATTAGTTGTTGGCCCTTTTGCTTTCTACCTTGCCTCATTTCACCTGAGAATCGTGAATATCTACATTGCCCCAATTGCAAAGCCTTTCTGGGCCTCTACGATCGTGAGAATAATTGCATTAAACCAAATCGTGAATTTGTGGTTTGTCCATTGTCTTCTAAACCATGTTCCTGTCCCGGTTGTAGTGCCCGGCCCAGTTCAAAAAAATGTCAATAA
- Protein Sequence
- MSEVPCDVQFVRCLKCLKVIKCSRYDTNGLVEHVAQDHPEIMEQANEKIKNLYKLAAEHGISQERLSQISKKTGMSEERLADEAEKYMAKKKKSGSNLSIVASGQNVAEGLAFRPNRAKACDSRDLSRRQYYRASIERWNATDGAIYCPSCGCCRRPVIQTKTEFYKSTGCCAACLISCWPFCFLPCLISPENREYLHCPNCKAFLGLYDRENNCIKPNREFVVCPLSSKPCSCPGCSARPSSKKCQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00612490;
- 90% Identity
- iTF_00524096;
- 80% Identity
- -