Dmer009912.2
Basic Information
- Insect
- Drosophila meridionalis
- Gene Symbol
- -
- Assembly
- GCA_035045145.1
- Location
- JAWNPG010000031.1:890125-891232[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.0014 5.3 7.3 0.0 18 48 81 111 77 115 0.91 2 7 0.0081 31 4.9 0.2 21 45 115 139 108 142 0.84 3 7 0.005 19 5.6 0.9 17 45 139 167 135 173 0.86 4 7 0.015 57 4.0 0.4 18 44 168 194 167 197 0.88 5 7 0.0021 8 6.8 0.6 17 44 195 222 189 226 0.89 6 7 0.00098 3.7 7.8 0.1 21 44 227 250 223 254 0.90 7 7 0.01 40 4.5 0.3 21 44 255 278 252 284 0.84
Sequence Information
- Coding Sequence
- ATGGCACAAACGATAGACGTGGCCTGCGTCAAGGAGGAGCACTGCGAGGCCATTTGCAATATGTTCAAGACTCAGGATTGGCAACTGACGATGCGACACAGAGATTTGGGCTTGGTCAAGATCGAGCAGGACATGAGCTTTGTGTGGCAGAGCAGCGCCAGTGCCACCACGGACAACAAGCAGCGGCAAGCAGCAGAGAAGCCAACACTGAAGAAGTGGGGAAACTTTGTGACCGAATTTCAGAGCGGCAGCGAGAAGCCCTTCAAGTGCGCCCACTGCCCCAAGGACTTCGCGACGAGCAGCAATCTCAAGGTGCacctcacacgcacacactccgGCGATCGCGAGCGACCCTTTCTGTGTCCCACCTGTCCAAAGTCCTTCGCGACGAACGACAACCTCCAGAAGCACATCCGGCGCCACTCGAGCGAGCGGACACTCAGTTGTCCACACTGCCCGAAGCTATTCGCCACCAAGGACAACCTGCAGAAGCACATCCGACGCCACTCCAGCGAAAGGACGCTCATCTGCCCGCACTGTCCGAAGGCCTTCGCCACCAACGACAACCTGCAGAAGCACATCCGACGCCACTCGAGCGAGAGGACCCTCAACTGCCCGCACTGCCCGAAGGCCTTCGCCACGAACGACAATCTGCAGCGCCACATCCGCGGCCACACGGGCGAGCGGCCCTTCAAGTGTCCCTACTGTGCGAAGCCCTTCGCCCAAAACCGAGATCTCAAGGCGCACATCCTGGAGCACACGGGCGAGAAGCCCTACAAGTGTCCCCACTGCCCCAAGGCGTGCGTGCGCAGCGAGGGCCTGAAGAAGCACATCCTGCGCCTGCACAAAGACATCGAGCCAGAGCCGACGCAGACGACGGCCAAGCATTGGCAAACGGACAAAACACTCGCAAGCGGGCGCGTCCTCATGTACAAATACGATCTGACCAAGCTAATGCCCACGGGCGAGGCGTAG
- Protein Sequence
- MAQTIDVACVKEEHCEAICNMFKTQDWQLTMRHRDLGLVKIEQDMSFVWQSSASATTDNKQRQAAEKPTLKKWGNFVTEFQSGSEKPFKCAHCPKDFATSSNLKVHLTRTHSGDRERPFLCPTCPKSFATNDNLQKHIRRHSSERTLSCPHCPKLFATKDNLQKHIRRHSSERTLICPHCPKAFATNDNLQKHIRRHSSERTLNCPHCPKAFATNDNLQRHIRGHTGERPFKCPYCAKPFAQNRDLKAHILEHTGEKPYKCPHCPKACVRSEGLKKHILRLHKDIEPEPTQTTAKHWQTDKTLASGRVLMYKYDLTKLMPTGEA
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00544875;
- 90% Identity
- iTF_00544875;
- 80% Identity
- iTF_00545381;