Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0014 5.3 7.3 0.0 18 48 81 111 77 115 0.91

2 7 0.0081 31 4.9 0.2 21 45 115 139 108 142 0.84

3 7 0.005 19 5.6 0.9 17 45 139 167 135 173 0.86

4 7 0.015 57 4.0 0.4 18 44 168 194 167 197 0.88

5 7 0.0021 8 6.8 0.6 17 44 195 222 189 226 0.89

6 7 0.00098 3.7 7.8 0.1 21 44 227 250 223 254 0.90

7 7 0.01 40 4.5 0.3 21 44 255 278 252 284 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0014	5.3	7.3	0.0	18	48	81	111	77	115	0.91
2	7	0.0081	31	4.9	0.2	21	45	115	139	108	142	0.84
3	7	0.005	19	5.6	0.9	17	45	139	167	135	173	0.86
4	7	0.015	57	4.0	0.4	18	44	168	194	167	197	0.88
5	7	0.0021	8	6.8	0.6	17	44	195	222	189	226	0.89
6	7	0.00098	3.7	7.8	0.1	21	44	227	250	223	254	0.90
7	7	0.01	40	4.5	0.3	21	44	255	278	252	284	0.84

Coding Sequence: ATGGCACAAACGATAGACGTGGCCTGCGTCAAGGAGGAGCACTGCGAGGCCATTTGCAATATGTTCAAGACTCAGGATTGGCAACTGACGATGCGACACAGAGATTTGGGCTTGGTCAAGATCGAGCAGGACATGAGCTTTGTGTGGCAGAGCAGCGCCAGTGCCACCACGGACAACAAGCAGCGGCAAGCAGCAGAGAAGCCAACACTGAAGAAGTGGGGAAACTTTGTGACCGAATTTCAGAGCGGCAGCGAGAAGCCCTTCAAGTGCGCCCACTGCCCCAAGGACTTCGCGACGAGCAGCAATCTCAAGGTGCacctcacacgcacacactccgGCGATCGCGAGCGACCCTTTCTGTGTCCCACCTGTCCAAAGTCCTTCGCGACGAACGACAACCTCCAGAAGCACATCCGGCGCCACTCGAGCGAGCGGACACTCAGTTGTCCACACTGCCCGAAGCTATTCGCCACCAAGGACAACCTGCAGAAGCACATCCGACGCCACTCCAGCGAAAGGACGCTCATCTGCCCGCACTGTCCGAAGGCCTTCGCCACCAACGACAACCTGCAGAAGCACATCCGACGCCACTCGAGCGAGAGGACCCTCAACTGCCCGCACTGCCCGAAGGCCTTCGCCACGAACGACAATCTGCAGCGCCACATCCGCGGCCACACGGGCGAGCGGCCCTTCAAGTGTCCCTACTGTGCGAAGCCCTTCGCCCAAAACCGAGATCTCAAGGCGCACATCCTGGAGCACACGGGCGAGAAGCCCTACAAGTGTCCCCACTGCCCCAAGGCGTGCGTGCGCAGCGAGGGCCTGAAGAAGCACATCCTGCGCCTGCACAAAGACATCGAGCCAGAGCCGACGCAGACGACGGCCAAGCATTGGCAAACGGACAAAACACTCGCAAGCGGGCGCGTCCTCATGTACAAATACGATCTGACCAAGCTAATGCCCACGGGCGAGGCGTAG
Protein Sequence: MAQTIDVACVKEEHCEAICNMFKTQDWQLTMRHRDLGLVKIEQDMSFVWQSSASATTDNKQRQAAEKPTLKKWGNFVTEFQSGSEKPFKCAHCPKDFATSSNLKVHLTRTHSGDRERPFLCPTCPKSFATNDNLQKHIRRHSSERTLSCPHCPKLFATKDNLQKHIRRHSSERTLICPHCPKAFATNDNLQKHIRRHSSERTLNCPHCPKAFATNDNLQRHIRGHTGERPFKCPYCAKPFAQNRDLKAHILEHTGEKPYKCPHCPKACVRSEGLKKHILRLHKDIEPEPTQTTAKHWQTDKTLASGRVLMYKYDLTKLMPTGEA

Sequence clustering based on sequence similarity using MMseqs2