Dana002106.1
Basic Information
- Insect
- Drosophila ananassae
- Gene Symbol
- litaf_1
- Assembly
- GCA_017639315.1
- Location
- CM029944.1:18119491-18119935[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.8e-28 2.5e-25 88.3 11.6 2 70 55 124 54 124 0.97
Sequence Information
- Coding Sequence
- ATGAGCAAGCCAGGCAGCAGTGCGCCACCGCAGTTCACCTATGTGCCGCCTCCCTCGGCGCCACCGTCCTACCAAGAGGCCGTGGGCGGAGTGAAGCCTGTGGGTCCCTACACCCCGGTGGCAAACACCACGATTGTGACCACTGTGGTGCCCATTAGCCGAACTTCGACCCACATGATCTGTCCTTCTTGTCATGCTGAGATCGAGACGACGACCCGCACAGAACCCGGAATGATTGCCTACTTGTCTGGATTTCTGATTGCATTGTTCGGTTGCTGGCTGGGATGCTGCCTGATACCCTGTTGCATCGACGACTGCATGGATGTCCACCACACGTGCCCCAACTGCCGGGCGTACCTGGGCCGCTATCGCCGATAA
- Protein Sequence
- MSKPGSSAPPQFTYVPPPSAPPSYQEAVGGVKPVGPYTPVANTTIVTTVVPISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHTCPNCRAYLGRYRR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00551970;
- 90% Identity
- iTF_00504355; iTF_00481895; iTF_00546319; iTF_00550609; iTF_00580340; iTF_00615255; iTF_00566456; iTF_00615867; iTF_00477692; iTF_00488381; iTF_00539325; iTF_00594913; iTF_00594211; iTF_00526244; iTF_00609540; iTF_00590629; iTF_00541446; iTF_00572264; iTF_00606729; iTF_00483338; iTF_00478381; iTF_00562125; iTF_00491886; iTF_00490448; iTF_00489042; iTF_00524786; iTF_00489747; iTF_00492628; iTF_00618004; iTF_00613173; iTF_00485526; iTF_00533464; iTF_00527707; iTF_00532029; iTF_00480544; iTF_00613856;
- 80% Identity
- iTF_00504355; iTF_00481895; iTF_00546319; iTF_00550609; iTF_00580340; iTF_00615255; iTF_00566456; iTF_00615867; iTF_00477692; iTF_00488381; iTF_00539325;