Dpar001120.1
Basic Information
- Insect
- Dorcus parallelipipedus
- Gene Symbol
- -
- Assembly
- GCA_958336345.1
- Location
- OY284475.1:8609052-8609750[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 8 0.093 1.2e+02 4.4 0.2 20 43 6 29 2 35 0.87 2 8 0.53 6.7e+02 2.0 0.1 26 44 40 58 33 62 0.84 3 8 2.4 3.1e+03 -0.2 0.0 21 45 64 88 60 95 0.73 4 8 0.17 2.1e+02 3.6 0.2 21 44 92 115 83 122 0.88 5 8 0.00016 0.2 13.3 0.1 20 46 120 146 116 152 0.86 6 8 0.002 2.6 9.7 0.4 21 44 149 172 146 177 0.91 7 8 0.01 13 7.5 0.2 21 44 177 200 173 204 0.92 8 8 0.019 24 6.6 0.3 21 43 205 227 200 231 0.88
Sequence Information
- Coding Sequence
- ATGTCAACGCACACCGGCAGCGAGAAGCTGTTCTGCTGTAAagtttgcgattacaagtgccgacAATCCGGAAGCATGAAGCAGCACGcgttaatacacaccggcgagaagctgTTCGTTTGTGAGCACTGCGGTTATAAATGCCGGCAACTCGGCAACTTGAAAAAGCACATATCAACACACACGggcggtgagaagccgttcggctgcaatctctgcgattacaagtgcGGATTGGCGACGGGTATGAGGAGTCACTTGCtgatacacaccggcgagaagccgctGAGTTGTTTCCTTTGCGGTTACAAATGTCGGCAGCACTCGCGTTTGAAACTGCACATGCTGACGCACACGGGAAGCAAGAAACCGCTGAGTTGCAACTTCTGTGATTTTAAGTGCCGACAGTCGGCGGATATGAGACGCCACGTGTTGATACACACCGACGAAAAGCCGATAAGTTGTGAGCTTTGCagttataaatgccgacagcccTCGAATTTAAAACAGCACATGCTAACACATACCGgagagaagccgttcagttgtgagcTTTGCGATCACAAGTGCCGAAGCGCCGGACACTTGAGACGGCACGTGGTGACGCACAGTGAGGAGAGGCCGTACAcctgtgacctttgcgattacagagGCCGAGAAATCTATCACCTGAGACGTCACAAGTTAACAcatcaataa
- Protein Sequence
- MSTHTGSEKLFCCKVCDYKCRQSGSMKQHALIHTGEKLFVCEHCGYKCRQLGNLKKHISTHTGGEKPFGCNLCDYKCGLATGMRSHLLIHTGEKPLSCFLCGYKCRQHSRLKLHMLTHTGSKKPLSCNFCDFKCRQSADMRRHVLIHTDEKPISCELCSYKCRQPSNLKQHMLTHTGEKPFSCELCDHKCRSAGHLRRHVVTHSEERPYTCDLCDYRGREIYHLRRHKLTHQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00465631;
- 90% Identity
- iTF_00466900;
- 80% Identity
- iTF_00466900;