Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.093 1.2e+02 4.4 0.2 20 43 6 29 2 35 0.87

2 8 0.53 6.7e+02 2.0 0.1 26 44 40 58 33 62 0.84

3 8 2.4 3.1e+03 -0.2 0.0 21 45 64 88 60 95 0.73

4 8 0.17 2.1e+02 3.6 0.2 21 44 92 115 83 122 0.88

5 8 0.00016 0.2 13.3 0.1 20 46 120 146 116 152 0.86

6 8 0.002 2.6 9.7 0.4 21 44 149 172 146 177 0.91

7 8 0.01 13 7.5 0.2 21 44 177 200 173 204 0.92

8 8 0.019 24 6.6 0.3 21 43 205 227 200 231 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.093	1.2e+02	4.4	0.2	20	43	6	29	2	35	0.87
2	8	0.53	6.7e+02	2.0	0.1	26	44	40	58	33	62	0.84
3	8	2.4	3.1e+03	-0.2	0.0	21	45	64	88	60	95	0.73
4	8	0.17	2.1e+02	3.6	0.2	21	44	92	115	83	122	0.88
5	8	0.00016	0.2	13.3	0.1	20	46	120	146	116	152	0.86
6	8	0.002	2.6	9.7	0.4	21	44	149	172	146	177	0.91
7	8	0.01	13	7.5	0.2	21	44	177	200	173	204	0.92
8	8	0.019	24	6.6	0.3	21	43	205	227	200	231	0.88

Coding Sequence: ATGTCAACGCACACCGGCAGCGAGAAGCTGTTCTGCTGTAAagtttgcgattacaagtgccgacAATCCGGAAGCATGAAGCAGCACGcgttaatacacaccggcgagaagctgTTCGTTTGTGAGCACTGCGGTTATAAATGCCGGCAACTCGGCAACTTGAAAAAGCACATATCAACACACACGggcggtgagaagccgttcggctgcaatctctgcgattacaagtgcGGATTGGCGACGGGTATGAGGAGTCACTTGCtgatacacaccggcgagaagccgctGAGTTGTTTCCTTTGCGGTTACAAATGTCGGCAGCACTCGCGTTTGAAACTGCACATGCTGACGCACACGGGAAGCAAGAAACCGCTGAGTTGCAACTTCTGTGATTTTAAGTGCCGACAGTCGGCGGATATGAGACGCCACGTGTTGATACACACCGACGAAAAGCCGATAAGTTGTGAGCTTTGCagttataaatgccgacagcccTCGAATTTAAAACAGCACATGCTAACACATACCGgagagaagccgttcagttgtgagcTTTGCGATCACAAGTGCCGAAGCGCCGGACACTTGAGACGGCACGTGGTGACGCACAGTGAGGAGAGGCCGTACAcctgtgacctttgcgattacagagGCCGAGAAATCTATCACCTGAGACGTCACAAGTTAACAcatcaataa
Protein Sequence: MSTHTGSEKLFCCKVCDYKCRQSGSMKQHALIHTGEKLFVCEHCGYKCRQLGNLKKHISTHTGGEKPFGCNLCDYKCGLATGMRSHLLIHTGEKPLSCFLCGYKCRQHSRLKLHMLTHTGSKKPLSCNFCDFKCRQSADMRRHVLIHTDEKPISCELCSYKCRQPSNLKQHMLTHTGEKPFSCELCDHKCRSAGHLRRHVVTHSEERPYTCDLCDYRGREIYHLRRHKLTHQ

Sequence clustering based on sequence similarity using MMseqs2