Dhop036381.1
Basic Information
- Insect
- Dorcus hopei
- Gene Symbol
- -
- Assembly
- GCA_033060865.1
- Location
- CM065425.1:72183109-72183732[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.081 1.1e+02 4.5 0.0 26 44 15 33 9 42 0.84 2 6 0.11 1.5e+02 4.1 0.3 21 44 64 87 56 91 0.83 3 6 0.00011 0.15 13.7 0.1 20 47 92 119 88 124 0.85 4 6 0.0024 3.4 9.4 0.2 21 44 121 144 117 148 0.91 5 6 0.042 59 5.4 0.0 21 43 149 171 146 176 0.88 6 6 0.11 1.5e+02 4.1 0.4 21 44 177 200 174 205 0.91
Sequence Information
- Coding Sequence
- ATGAAGCAGCACGCATTCATACACACCGGGGAGAAGCTGTTCGTTTGTGAACACTGCGGCTATAAATGCCGGCAACTCGGCAACTTGAGAAAGCACATACTAACACACACAGGCGGTGAGAAACCGTTCGACTGCGATTACAAGTGCGGATTGGCGACGGGTATGAGGAGTCACTTGctgatacacaccggcgagaagccgccGAGTTGTTTCCTTTGCGGTTACAAATGTCGGCAGCAGTCGCGTTTAAAACTGCACATGCTGACGCACACGGGAAGCAAGAAACCGCTGAGTTGTAACTTCTGCGATTTTAAGTGCCGACAATCGGCGGATATGAGACGCCACGTGTTGATGCACACCGACGAAAAGCCGATAGGTTGTGAGCTTTGCAGTTATAAATGCCGGCAGCCCTCGAATTTAAAACAGCACATGTTAACACATAAcggcgagaagccattcagttgtgatctctgcgattacaaatgccgacaggTCGGGAATTTGACTCTGCACAAGTTAACacataccgacgagaagcctatactttgtggtctttgcgattacagatgCCGAAGACTTGAGCATTTGAAGCGGCATATGTTAAAGTACAcgagaaaaacataa
- Protein Sequence
- MKQHAFIHTGEKLFVCEHCGYKCRQLGNLRKHILTHTGGEKPFDCDYKCGLATGMRSHLLIHTGEKPPSCFLCGYKCRQQSRLKLHMLTHTGSKKPLSCNFCDFKCRQSADMRRHVLMHTDEKPIGCELCSYKCRQPSNLKQHMLTHNGEKPFSCDLCDYKCRQVGNLTLHKLTHTDEKPILCGLCDYRCRRLEHLKRHMLKYTRKT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00465429; iTF_00467133; iTF_00466900;
- 90% Identity
- iTF_00465429;
- 80% Identity
- iTF_00465429;