Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.081 1.1e+02 4.5 0.0 26 44 15 33 9 42 0.84

2 6 0.11 1.5e+02 4.1 0.3 21 44 64 87 56 91 0.83

3 6 0.00011 0.15 13.7 0.1 20 47 92 119 88 124 0.85

4 6 0.0024 3.4 9.4 0.2 21 44 121 144 117 148 0.91

5 6 0.042 59 5.4 0.0 21 43 149 171 146 176 0.88

6 6 0.11 1.5e+02 4.1 0.4 21 44 177 200 174 205 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.081	1.1e+02	4.5	0.0	26	44	15	33	9	42	0.84
2	6	0.11	1.5e+02	4.1	0.3	21	44	64	87	56	91	0.83
3	6	0.00011	0.15	13.7	0.1	20	47	92	119	88	124	0.85
4	6	0.0024	3.4	9.4	0.2	21	44	121	144	117	148	0.91
5	6	0.042	59	5.4	0.0	21	43	149	171	146	176	0.88
6	6	0.11	1.5e+02	4.1	0.4	21	44	177	200	174	205	0.91

Coding Sequence: ATGAAGCAGCACGCATTCATACACACCGGGGAGAAGCTGTTCGTTTGTGAACACTGCGGCTATAAATGCCGGCAACTCGGCAACTTGAGAAAGCACATACTAACACACACAGGCGGTGAGAAACCGTTCGACTGCGATTACAAGTGCGGATTGGCGACGGGTATGAGGAGTCACTTGctgatacacaccggcgagaagccgccGAGTTGTTTCCTTTGCGGTTACAAATGTCGGCAGCAGTCGCGTTTAAAACTGCACATGCTGACGCACACGGGAAGCAAGAAACCGCTGAGTTGTAACTTCTGCGATTTTAAGTGCCGACAATCGGCGGATATGAGACGCCACGTGTTGATGCACACCGACGAAAAGCCGATAGGTTGTGAGCTTTGCAGTTATAAATGCCGGCAGCCCTCGAATTTAAAACAGCACATGTTAACACATAAcggcgagaagccattcagttgtgatctctgcgattacaaatgccgacaggTCGGGAATTTGACTCTGCACAAGTTAACacataccgacgagaagcctatactttgtggtctttgcgattacagatgCCGAAGACTTGAGCATTTGAAGCGGCATATGTTAAAGTACAcgagaaaaacataa
Protein Sequence: MKQHAFIHTGEKLFVCEHCGYKCRQLGNLRKHILTHTGGEKPFDCDYKCGLATGMRSHLLIHTGEKPPSCFLCGYKCRQQSRLKLHMLTHTGSKKPLSCNFCDFKCRQSADMRRHVLMHTDEKPIGCELCSYKCRQPSNLKQHMLTHNGEKPFSCDLCDYKCRQVGNLTLHKLTHTDEKPILCGLCDYRCRRLEHLKRHMLKYTRKT

Sequence clustering based on sequence similarity using MMseqs2