Basic Information

Insect: Dorcus parallelipipedus
Gene Symbol: -
Assembly: GCA_958336345.1
Location: OY284475.1:7839638-7840687[-]

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 12 0.36 4.6e+02 2.5 0.1 26 44 18 36 8 40 0.86

2 12 0.0058 7.2 8.2 0.1 21 46 40 64 36 68 0.85

3 12 0.0033 4.1 9.0 0.2 21 44 68 91 64 96 0.90

4 12 0.074 93 4.7 0.1 21 44 96 119 92 124 0.90

5 12 0.13 1.6e+02 3.9 0.0 21 46 124 149 120 152 0.90

6 12 0.005 6.3 8.4 0.2 21 44 152 175 148 183 0.86

7 12 1.5 1.9e+03 0.5 0.1 22 44 181 203 177 207 0.87

8 12 0.044 55 5.4 0.1 21 49 208 235 204 239 0.87

9 12 0.18 2.2e+02 3.5 0.1 22 46 237 260 236 264 0.87

10 12 0.4 5.1e+02 2.3 0.1 21 43 264 286 260 291 0.87

11 12 0.011 14 7.3 0.1 21 46 292 316 288 323 0.86

12 12 6.4 8.1e+03 -1.5 0.0 27 44 322 339 318 343 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	12	0.36	4.6e+02	2.5	0.1	26	44	18	36	8	40	0.86
2	12	0.0058	7.2	8.2	0.1	21	46	40	64	36	68	0.85
3	12	0.0033	4.1	9.0	0.2	21	44	68	91	64	96	0.90
4	12	0.074	93	4.7	0.1	21	44	96	119	92	124	0.90
5	12	0.13	1.6e+02	3.9	0.0	21	46	124	149	120	152	0.90
6	12	0.005	6.3	8.4	0.2	21	44	152	175	148	183	0.86
7	12	1.5	1.9e+03	0.5	0.1	22	44	181	203	177	207	0.87
8	12	0.044	55	5.4	0.1	21	49	208	235	204	239	0.87
9	12	0.18	2.2e+02	3.5	0.1	22	46	237	260	236	264	0.87
10	12	0.4	5.1e+02	2.3	0.1	21	43	264	286	260	291	0.87
11	12	0.011	14	7.3	0.1	21	46	292	316	288	323	0.86
12	12	6.4	8.1e+03	-1.5	0.0	27	44	322	339	318	343	0.83

Sequence Information

Coding Sequence: ATGAACAGTCTAACTAGTCTAAGAAATAACGGTTGTTCCAGATGCGAACTCAGATGCGCCGTTTGCGGTTCCGAGTTTCAACACTCGGCGAACTTGAAGCAGCACGTGTCGACGCACACTGAGAAGTCCTTCGGCTGCGACAtctgcgattacaagtgccgaaAATCGGCGGATCTGAAGCGGCACATGTTGAAACACACCCAGGAGAAGCCGCACGTTTGCGGCCTCTGCGACTACAAATGCCGATACGCCGAGAATTTGAAGCGGCACATGTTgacgcacaccgacgagaagccctTGAATTGCAcgctttgcgattacaagtgccgacAGTACGGCAGTTTGAAAAAGCACATACTagcgcacaccggcgagaagccctTCAGCTGCGAAGTTTGCGACTGCAAGTTCGAGGAGCAAGGAAAACTAAAGCGGCACATGTCGATACACACAGGCGAGAGACCGTACGGTTGTGAcctctgcgattataagtgccgacagCCCGGATATCTGCGGCGTCACATGCTGACGCACACCGACGACAAGCCATTCAgctgtgacctttgcgattataaatgtcgatacCCCGAGAGTATGAAACGGCACGTGTTAACGCACACGGgggagaagccgttcagttgtgaccacTGCGAGTATAAATGCGTACAATCGACGTATTTGAAGCAGCACCTGCTAACACACTTCGACGacaagccgttcagttgcgatctttgcgactaCAAGTGCCGAAAATCGGCGTACCTTAAGCAGCACATGCTGaaacataccggcgagaagccgttcggctGTGAgttttgcgattataaatgtcggcaACTCACGAGCTTGAAACAGCACACGCTGCAACACACCGGCGAAAAACCTTTCACTTGcaacctttgcgattacaaatgccggcAGCCCGGAAGGTTGAAGGAACACATGTTGAAGCACACCTTCGGTTGTGATAGTTGCGACTTGAAATTTCGAGAGGATGAGGAGTTGAAACGACACGTGTTAACACACACTGAAGAGAAGTCAAGCATTTAA
Protein Sequence: MNSLTSLRNNGCSRCELRCAVCGSEFQHSANLKQHVSTHTEKSFGCDICDYKCRKSADLKRHMLKHTQEKPHVCGLCDYKCRYAENLKRHMLTHTDEKPLNCTLCDYKCRQYGSLKKHILAHTGEKPFSCEVCDCKFEEQGKLKRHMSIHTGERPYGCDLCDYKCRQPGYLRRHMLTHTDDKPFSCDLCDYKCRYPESMKRHVLTHTGEKPFSCDHCEYKCVQSTYLKQHLLTHFDDKPFSCDLCDYKCRKSAYLKQHMLKHTGEKPFGCEFCDYKCRQLTSLKQHTLQHTGEKPFTCNLCDYKCRQPGRLKEHMLKHTFGCDSCDLKFREDEELKRHVLTHTEEKSSI

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00465267;
90% Identity: iTF_00467111;
80% Identity: iTF_00467111;