Basic Information

Insect: Dorcus hopei
Gene Symbol: -
Assembly: GCA_033060865.1
Location: CM065425.1:72731319-72732389[+]

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 12 0.36 5e+02 2.4 0.1 26 44 21 39 11 43 0.86

2 12 0.0086 12 7.6 0.1 21 48 43 69 40 76 0.79

3 12 0.0027 3.8 9.2 0.2 21 44 71 94 68 102 0.87

4 12 0.079 1.1e+02 4.5 0.1 21 44 99 122 96 126 0.90

5 12 0.16 2.2e+02 3.6 0.0 21 46 127 152 124 154 0.90

6 12 0.003 4.2 9.1 0.4 21 44 155 178 150 186 0.86

7 12 1.3 1.8e+03 0.6 0.1 22 44 184 206 179 212 0.87

8 12 0.04 55 5.5 0.1 21 50 211 239 208 243 0.86

9 12 0.16 2.2e+02 3.6 0.1 22 46 240 263 238 267 0.87

10 12 0.21 3e+02 3.1 0.1 21 44 267 290 264 295 0.87

11 12 0.013 18 7.1 0.1 21 47 295 320 290 325 0.88

12 12 4.3 5.9e+03 -1.0 0.0 24 44 326 346 320 354 0.78

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	12	0.36	5e+02	2.4	0.1	26	44	21	39	11	43	0.86
2	12	0.0086	12	7.6	0.1	21	48	43	69	40	76	0.79
3	12	0.0027	3.8	9.2	0.2	21	44	71	94	68	102	0.87
4	12	0.079	1.1e+02	4.5	0.1	21	44	99	122	96	126	0.90
5	12	0.16	2.2e+02	3.6	0.0	21	46	127	152	124	154	0.90
6	12	0.003	4.2	9.1	0.4	21	44	155	178	150	186	0.86
7	12	1.3	1.8e+03	0.6	0.1	22	44	184	206	179	212	0.87
8	12	0.04	55	5.5	0.1	21	50	211	239	208	243	0.86
9	12	0.16	2.2e+02	3.6	0.1	22	46	240	263	238	267	0.87
10	12	0.21	3e+02	3.1	0.1	21	44	267	290	264	295	0.87
11	12	0.013	18	7.1	0.1	21	47	295	320	290	325	0.88
12	12	4.3	5.9e+03	-1.0	0.0	24	44	326	346	320	354	0.78

Sequence Information

Coding Sequence: ATGCTGTATACGAACAGTCTATCTAGTCTAAGAAATAACGGTTGTTCCAGATGTGAACTCAGATGCGCCGTTTGCGATTCCGAATTTCAATACTCGGCGAACTTGAAGCAGCACATGTCGACGCACACGGAGAAGTCCTTCGGCTGCGACgtctgcgattacaaatgccgaaaaTCGGCGGATCTGAAGCGGCACATGTTGAAACACACCGAGGAGAAGCCGCACGTTTGCGGCCTCTGCGACTATAAGTGCCGATACGCCGAGAATTTGAAGCggcacatgttaacgcacaccgacgagaagccctTGAATTGCAcgctttgcgattacaaatgccgacagtACGGGAGTTTGAAGAAGCACATACTAgcacataccggcgagaagccctTCAGCTGCGAGGTTTGCGATTGCAAGTTCGAGGAGCACGGAAAACTAAAGCGGCACATGTcgatacacaccggcgagagaCCGTACAGTTGTGAcctctgcgattataagtgccgacaGCCCGGATATTTGCGGCGCCACATGCTGACGCACACCGACGACAAGCCGTTCAgctgtgacctttgcgattataaatgccgatacCCCGAGAGTATGAAACGGCACGTGTTAACGCACACGGgggagaagccgttcagttgtgaccacTGCGACTATAAGTGCGTACAATCGACGTATTTGAAGCAGCACCTGCTGACACACTTCGACGacaagccgttcagttgtgatctttgcgactacAAGTGCCGGAAATCGGCGTACCTTAAACAGCACATGCTGaaacataccggcgagaagccgttcagctgtgacttttgcgattataaatgtcggcaGCTCACGAGCTTGAAACAACACACGCTGCAGCACACCGGCGAAAAACCATTCACTTGcaacctttgcgattacaaatgccggcAGCCCGGAAGGTTGAAGGAACACATGCtgaagcacaccggtgagaggACCTTCGGTTGTGATAATTGCGATTTGAAATTTCGCGAGGATGGGGAGTTGAAACGGCACGTGTTAACACACACTGAAGAGAAGCCAATTATTTAA
Protein Sequence: MLYTNSLSSLRNNGCSRCELRCAVCDSEFQYSANLKQHMSTHTEKSFGCDVCDYKCRKSADLKRHMLKHTEEKPHVCGLCDYKCRYAENLKRHMLTHTDEKPLNCTLCDYKCRQYGSLKKHILAHTGEKPFSCEVCDCKFEEHGKLKRHMSIHTGERPYSCDLCDYKCRQPGYLRRHMLTHTDDKPFSCDLCDYKCRYPESMKRHVLTHTGEKPFSCDHCDYKCVQSTYLKQHLLTHFDDKPFSCDLCDYKCRKSAYLKQHMLKHTGEKPFSCDFCDYKCRQLTSLKQHTLQHTGEKPFTCNLCDYKCRQPGRLKEHMLKHTGERTFGCDNCDLKFREDGELKRHVLTHTEEKPII

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00465267;
90% Identity: iTF_00465267;
80% Identity: iTF_00465267;