Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.24 2.6e+02 2.3 0.1 19 52 12 45 6 46 0.84

2 7 0.0079 8.5 7.1 0.0 22 49 43 70 40 73 0.85

3 7 0.041 44 4.8 0.0 21 51 70 100 68 101 0.87

4 7 0.0027 2.9 8.6 0.1 21 46 98 123 94 131 0.89

5 7 0.006 6.5 7.5 0.0 21 52 130 161 124 163 0.88

6 7 0.0052 5.6 7.7 0.0 21 51 158 188 156 189 0.88

7 7 0.0023 2.5 8.8 0.3 21 46 186 211 184 220 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.24	2.6e+02	2.3	0.1	19	52	12	45	6	46	0.84
2	7	0.0079	8.5	7.1	0.0	22	49	43	70	40	73	0.85
3	7	0.041	44	4.8	0.0	21	51	70	100	68	101	0.87
4	7	0.0027	2.9	8.6	0.1	21	46	98	123	94	131	0.89
5	7	0.006	6.5	7.5	0.0	21	52	130	161	124	163	0.88
6	7	0.0052	5.6	7.7	0.0	21	51	158	188	156	189	0.88
7	7	0.0023	2.5	8.8	0.3	21	46	186	211	184	220	0.89

Coding Sequence: ATGCAAACGTCGCGAACACCCGGAATGAAGGTGTCCAGTTGCAGCAAGCCATTTCAGTGTACCGAGTGTGAGAAACAGTTCCGGCAGCTAAGCACGCTAACCAACCACATGAAGATCCACACAGGAGATAAACCCTACAAATGCACAATCTGCGCGAAGGAGTTCCGGCAGACGACGACGCTGTCCAACCATGTGAAGATTCACACGGGGGAGAAACCGTTTCACTGCACATATTGTGGCAAACAATTCCGGCAGTTGAGCACCCTGTCGAATCATCTCAAAATTCACACTGGTGAAAAGCCCTACGAATGCTCAGTCTGTGGCAAGCAGTTCCGGCAGTCTAGCACGCTGAACAGCCACATCCGGATCCACTCGGACGACAAGTATTCTGTGAAACCCTTCAAGTGCAGCATGTGCCCCAAGGAGTTCCGCCAAACTACGACCCTGTCAAACCACCTGAAAATTCACACAGGTGAAAAGCCCTACGTTTGTACATATTGCAATAAAAGTTTTCGGCAGACAGGGACGCTCTCAAACCATCTTAAAATTCATACTGGAGAAAAACCTTACGAATGTTCCGTTTGTCGGAAGCAATTCCGGCAGTCGAGCACGCTGAACTCGCACATCCGGATCCACGCGGATGACAAGCTAAGTAAACCCTCCCCTCCGGAGCTGCCTACTACGATGACCACTATCACGATGAAGCTGGAAGATATTAAACCGCTCTACACGATCATTTAA
Protein Sequence: MQTSRTPGMKVSSCSKPFQCTECEKQFRQLSTLTNHMKIHTGDKPYKCTICAKEFRQTTTLSNHVKIHTGEKPFHCTYCGKQFRQLSTLSNHLKIHTGEKPYECSVCGKQFRQSSTLNSHIRIHSDDKYSVKPFKCSMCPKEFRQTTTLSNHLKIHTGEKPYVCTYCNKSFRQTGTLSNHLKIHTGEKPYECSVCRKQFRQSSTLNSHIRIHADDKLSKPSPPELPTTMTTITMKLEDIKPLYTII

Sequence clustering based on sequence similarity using MMseqs2