Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0062 3.7 7.9 0.0 20 48 143 171 135 175 0.85

2 6 0.072 43 4.5 0.0 22 52 173 203 170 204 0.89

3 6 0.05 30 5.0 0.6 13 44 201 232 198 236 0.86

4 6 0.00095 0.57 10.5 0.0 21 46 237 262 233 267 0.90

5 6 0.46 2.8e+02 1.9 0.1 22 45 266 289 261 292 0.81

6 6 0.0012 0.7 10.3 0.1 21 48 293 320 284 324 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0062	3.7	7.9	0.0	20	48	143	171	135	175	0.85
2	6	0.072	43	4.5	0.0	22	52	173	203	170	204	0.89
3	6	0.05	30	5.0	0.6	13	44	201	232	198	236	0.86
4	6	0.00095	0.57	10.5	0.0	21	46	237	262	233	267	0.90
5	6	0.46	2.8e+02	1.9	0.1	22	45	266	289	261	292	0.81
6	6	0.0012	0.7	10.3	0.1	21	48	293	320	284	324	0.87

Coding Sequence: atgaaaatctcaaaaaaggGTATAGGCATCGACCCTTGCACCCCCGTGTCACGGCCCAAAGAAGACGATACAAGGGGGAAGAGGTTATGTGAGGGCGGAGCGGCAACACCGACGAAGCAACGCCCCCTACCACGGAACGAGGAGATTACCGATCCGATCTTGGCGTCCCGTAGGAACATCTGCCGAAAATGTAAGTCACGTTACGAGGAATTCTTGAGGTATATCGAGACGTGTAAGGCCCATGCGTCTGTAGTAGAGAAGGTACTGGCCATAAGGCAAATCAAAGACGAACCCACGGTCAATATCGTGTGTCATCCGTTAATCGAGGAAGAAATTCTAACCGTTCCTCAGTTGTCTTTTAAGTGTCTACTGTGCGACAAGGCTTATACTCGGTCTAGTAAGTTGAAGACGCATATGAGCGTCCATACGGgcgaaaggccttttaaatgcCTCGtttgtaataaggcttttacttcGAACGATaacttgaaaaggcacatgcgcttCCACACGAGGGAGAAGCCCTTCAAATGTTCCGTCTGTGATAAGAACTTCAGTGAATCCGGTagtttgaaaacgcacatgcgcctcCATACGGGGGAAAAGCCGTTTAAATGCCCGCTATgtgaaaggccttttaaatgttccctctgTAATAACGCTTTCACTACGTCTAGTCACTTAAAAAATCACATGCGCTGTCACACGGGCGAGAAACCTTTCGAATGTCCCGTCTGTAATAAGACCTTCCCTCGGTCTGATAACTTGAAAATGCACATGCGCGTCCATACGGGCGAGAAGTCTTTCAACTGTCCGGTCTGTAATAAGAGTTTCGCCCGGTCCGTTCACGTGAAGACCCACATGCGCGTCCACACGGGCGAAAGGCCCTTTCAATGTTCCGTCTGTTTTAAGGCTTTTACTTTGTCCGGGGCTCTTAagaggcacatgcgccttcacgCCGTCGACAATCCCTAA
Protein Sequence: MKISKKGIGIDPCTPVSRPKEDDTRGKRLCEGGAATPTKQRPLPRNEEITDPILASRRNICRKCKSRYEEFLRYIETCKAHASVVEKVLAIRQIKDEPTVNIVCHPLIEEEILTVPQLSFKCLLCDKAYTRSSKLKTHMSVHTGERPFKCLVCNKAFTSNDNLKRHMRFHTREKPFKCSVCDKNFSESGSLKTHMRLHTGEKPFKCPLCERPFKCSLCNNAFTTSSHLKNHMRCHTGEKPFECPVCNKTFPRSDNLKMHMRVHTGEKSFNCPVCNKSFARSVHVKTHMRVHTGERPFQCSVCFKAFTLSGALKRHMRLHAVDNP

Sequence clustering based on sequence similarity using MMseqs2