Ccon007674.1
Basic Information
- Insect
- Cotesia congregata
- Gene Symbol
- -
- Assembly
- None
- Location
- contig:8467892-8468515[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 1.1 4.2e+03 -1.4 0.0 18 31 26 39 23 44 0.79 2 6 0.028 1e+02 3.8 0.1 21 46 57 82 53 88 0.82 3 6 0.0012 4.5 8.2 0.1 22 44 86 108 78 111 0.88 4 6 0.0027 9.8 7.1 0.1 21 45 113 137 108 143 0.89 5 6 0.00016 0.58 11.0 0.4 20 45 143 168 138 172 0.85 6 6 0.0027 10 7.0 0.2 18 46 169 197 168 201 0.87
Sequence Information
- Coding Sequence
- ATGACGACAAAATACAGATGTGAGATCTGTTCAAAAAGTTACATCTCAAAAGAGGGCCTGACCCTTCACACAGCTAGGCATACAGGCGACATGCCCTACGAGTGTGAAATTTGTGCTTCTAAATTCACGGTCAAATTTACTTACGACAATCACATGCGAATCCACAACGGCGAAAAGCCCTTCGCTTGTAACGTTTGTTCCTCGAAGTTCCGCGAAAAAAGCCAGCTGACCGTCCACCAGCGGATTCACTCAGGTGACAAGCCCTACGCTTGTAACTTTTGCTCAACGAAGTTTCGTCACAGTGGCAACTTGAAGGCTCACATTAGAACTCACACCGACGAGCGGCCTTTCAGTTGCGATAAATGCTCCGCAAAATTCCGGGATCCTTCGACGCTAAAGAGGCACAAGCAAATTCACAGTGGAGAGAAAAAAGAAAAACGGTATTCTTGTAAAATTTGCTCCTGCAAACTTAGAGATAGTTACAATTTGAAAATTCACTTACGCAGGCATACTGGAGAGCGGCCTTTTGCTTGTCAAATTTGCTTTGTGAAATTCACTGAAAAGTGCTCGTTGAACAAACACATGAAAATTCATCAGAAGAAAATTAAGGAAGAAAAATTGTGA
- Protein Sequence
- MTTKYRCEICSKSYISKEGLTLHTARHTGDMPYECEICASKFTVKFTYDNHMRIHNGEKPFACNVCSSKFREKSQLTVHQRIHSGDKPYACNFCSTKFRHSGNLKAHIRTHTDERPFSCDKCSAKFRDPSTLKRHKQIHSGEKKEKRYSCKICSCKLRDSYNLKIHLRRHTGERPFACQICFVKFTEKCSLNKHMKIHQKKIKEEKL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00380560;
- 90% Identity
- iTF_00380757;
- 80% Identity
- iTF_00379124;