Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0011 7.8 6.9 0.1 21 46 14 39 3 41 0.89

2 4 7e-05 0.5 10.8 0.1 21 51 42 72 38 73 0.87

3 4 0.0035 25 5.3 0.0 21 49 70 98 67 101 0.86

4 4 9.4e-05 0.67 10.4 0.0 21 46 98 123 94 128 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0011	7.8	6.9	0.1	21	46	14	39	3	41	0.89
2	4	7e-05	0.5	10.8	0.1	21	51	42	72	38	73	0.87
3	4	0.0035	25	5.3	0.0	21	49	70	98	67	101	0.86
4	4	9.4e-05	0.67	10.4	0.0	21	46	98	123	94	128	0.91

Coding Sequence: ATGTCGAGAGCACTCAGCAGAACAATGAAATTGCCCAATACTGAAAAGCCATTTCAGTGCAACGTTTGTGAGAAACAGTTTCGTCAATTAAGTACGCTAGCGAACCACATGAAGATACATACAGGGGAAAAGCCATTTAaaTGCCATGTGTGCAGTCGAGAATTTAGGCAGAGTTCAACATTGACGAATCATATAAAGATTCATACGGGAGAGAAACCATACAattgtACCTTCTGTGGTAAGCAGTTCCGACAACTTAGCACGTTAAGTAATCATGTTAAAATACATACGGGTGAGAAGCCGTTTGAATGTGTTGTTTGTAAGAAACAATTTAgGCAATCGTCGACGCTAAATAACCACATTAAGATTCATACTGGTGACAAATTCGTTATCTGA
Protein Sequence: MSRALSRTMKLPNTEKPFQCNVCEKQFRQLSTLANHMKIHTGEKPFKCHVCSREFRQSSTLTNHIKIHTGEKPYNCTFCGKQFRQLSTLSNHVKIHTGEKPFECVVCKKQFRQSSTLNNHIKIHTGDKFVI

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01257389;
90% Identity: iTF_00320229; iTF_00199306; iTF_00319978; iTF_01250477; iTF_01257389; iTF_00346996; iTF_01353109; iTF_01250743; iTF_01353401; iTF_01257630; iTF_00199520;
80% Identity: iTF_00199306; iTF_00346996; iTF_01353109; iTF_01353401; iTF_00199520;