Cruf013683.1
Basic Information
- Insect
- Chrysomya rufifacies
- Gene Symbol
- -
- Assembly
- GCA_014858695.1
- Location
- JACGTJ010028748.1:248-2655[-]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.2e-12 5.8e-09 36.0 13.4 2 68 56 125 55 126 0.86
Sequence Information
- Coding Sequence
- ATGACAGCGACAACAACTAATGAACAAAAACCCGCCAATATTGAGGTGGTCATCGATGAAAAGGCCAAAAAGGCCGGTGAAAAAATGTTGAGAGCCCAAAAGGAACAAGAAATCTACAATAATTTTGCTACACCTTTAGTGGGCACCTATTTGAATTTGACACACGAACCAGCCCTTATTAAATGTCCCAGTTGTGGCATAGAGGAATACAGTGAAGTGGTCGAGGAGCTTAAATGGTGGGCCACAGAAATCAATCGTTTTCTAGGATGTTTATTTGTAACTTTATGCTGTTGCTGCTGTTTGGACTATAGCCTGCCCTGTAAATCCAGTGATCGTAATCATTATTGCAAAAATTGTGGCTGCTTTTTTGGACGTGCTTTGCGTGTTGCTCCTCTAAAAAATGTCAAAACACCCAAAAAGTGA
- Protein Sequence
- MTATTTNEQKPANIEVVIDEKAKKAGEKMLRAQKEQEIYNNFATPLVGTYLNLTHEPALIKCPSCGIEEYSEVVEELKWWATEINRFLGCLFVTLCCCCCLDYSLPCKSSDRNHYCKNCGCFFGRALRVAPLKNVKTPKK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01194954; iTF_01259759; iTF_00350680; iTF_01400033; iTF_01162764; iTF_01238236; iTF_00893537; iTF_01261569; iTF_01109795; iTF_01399142; iTF_01316007; iTF_01314344; iTF_00371821; iTF_00200431; iTF_01166255; iTF_01177487; iTF_01138640; iTF_00742449; iTF_01236337; iTF_00976116; iTF_00045813; iTF_01374645; iTF_00655768; iTF_00259451; iTF_00436155; iTF_01377148; iTF_01398108; iTF_00260351; iTF_00760671; iTF_00922591; iTF_01427967; iTF_01174752; iTF_00717379;
- 90% Identity
- -
- 80% Identity
- -