Basic Information

Transcription Factor Domain

TF Family: GCFC
Domain: GCFC domain
PFAM: PF07842
TF Group: Unclassified Structure
Description: This entry describes a domain found in a number of GC-rich sequence DNA-binding factor proteins and homologues [4, 5], as well as in a number of other proteins including Tuftelin-interacting protein 11 [1]. While the function of the domain is unknown, some of the proteins it is found in are reported to be involved in pre-mRNA splicing [1, 2]. This domain is also found in Sip1, a septin interacting protein [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 1.5e-19 1.9e-15 57.7 0.5 100 272 4 144 1 146 0.88

2 2 0.18 2.4e+03 -1.6 0.1 179 193 185 199 159 217 0.52

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	1.5e-19	1.9e-15	57.7	0.5	100	272	4	144	1	146	0.88
2	2	0.18	2.4e+03	-1.6	0.1	179	193	185	199	159	217	0.52

Coding Sequence: ATGAAAGAGACTGAGGAATCACTGCGATGTGATCCAGACGTTCGGTTGATTCCGTCAacgattgaaaaaattgttgttcCAAAATTGACAAcgATTGTCGAGAAAATATGGGACCCAATGTCGACGTCACAGACGCTTCGACTAGTCGGACTAATTAATCGTTTAATCAGAGATTATCCAAATTTAAATGAAACCAGTAAACAGCTGGAAACTCTTTTCAATGCCAtactcgagaaaataaaagcagctGTGGAGAATGATGTTTTTATTCCAATATTTCCCAAACAagTCATGGATACAAAACACCAATTTTATCAACGTCAATTTGCCATGGCAATTAAGTTACTCCGAAATTTGCTGAGTTGGCAGGGTCTATTGGGTGATctcaaactaaaaaatatcGCATTAGGATCGTTATTGAATAGATATCTTGTCGCTGGATTACGAGTTTCACCTCCTGTTGATGCTCTTACCAAAGCTAATATGATCATGAGCACGCTACCACGGGCATGGCTGCAGGGAGAAACGATCgaacatttaaaaatgtttgcgACTCTAATCCGCCAACTCAGCGAACAACTTGATCAAGCTAATCCAACTCACAAcGAGGCATGGGAATACTCGAAATCTATCTTGAAGATAATCAAACCTCTGTAA
Protein Sequence: MKETEESLRCDPDVRLIPSTIEKIVVPKLTTIVEKIWDPMSTSQTLRLVGLINRLIRDYPNLNETSKQLETLFNAILEKIKAAVENDVFIPIFPKQVMDTKHQFYQRQFAMAIKLLRNLLSWQGLLGDLKLKNIALGSLLNRYLVAGLRVSPPVDALTKANMIMSTLPRAWLQGETIEHLKMFATLIRQLSEQLDQANPTHNEAWEYSKSILKIIKPL

Sequence clustering based on sequence similarity using MMseqs2