Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0062 1.1e+02 2.6 3.2 11 16 13 18 11 19 0.82

2 5 0.092 1.7e+03 -1.2 2.1 12 15 32 35 31 36 0.93

3 5 3.9e-10 7.1e-06 25.6 2.2 4 21 52 69 50 70 0.87

4 5 0.61 1.1e+04 -3.8 6.9 10 15 79 84 78 85 0.83

5 5 1 1.8e+04 -5.3 1.3 6 9 89 92 88 92 0.72

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0062	1.1e+02	2.6	3.2	11	16	13	18	11	19	0.82
2	5	0.092	1.7e+03	-1.2	2.1	12	15	32	35	31	36	0.93
3	5	3.9e-10	7.1e-06	25.6	2.2	4	21	52	69	50	70	0.87
4	5	0.61	1.1e+04	-3.8	6.9	10	15	79	84	78	85	0.83
5	5	1	1.8e+04	-5.3	1.3	6	9	89	92	88	92	0.72

Coding Sequence: ATGTCTGACGACGGTTCAACAGTTGTTGAAAAGAAAGGACGCGGTAGACCAAAAGCCAATGGAACACAACCTGAGTCGAAAGAACTTAAAAAACGAGGTCGGCCTCCAGCTGCCACCAGAACAAAAGATTCTGCTAAGTCTTCTGATGATGAACAAGCACCAGTAGCTAAACGAGGTAGAGGCAGACCAAAAGGTTCCAAGAAAAAAGCGGGAGTCAAGGGCAAGGGTGAAGGTAGAGGTCGTGGACGGCCACGCAAAGATGCACCACCTCCAAAAAAAGATGCTGCTTCTACTGAGGAAGAACAGGACGAGGATGAAGAAGATGAAGGATCTGAAGACCAATAA
Protein Sequence: MSDDGSTVVEKKGRGRPKANGTQPESKELKKRGRPPAATRTKDSAKSSDDEQAPVAKRGRGRPKGSKKKAGVKGKGEGRGRGRPRKDAPPPKKDAASTEEEQDEDEEDEGSEDQ

Sequence clustering based on sequence similarity using MMseqs2