Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 1.4 1.5e+03 -1.0 0.0 22 45 84 107 81 110 0.84

2 7 0.0025 2.8 7.7 0.0 21 45 111 135 103 142 0.88

3 7 0.0008 0.91 9.3 0.1 22 45 140 163 135 170 0.88

4 7 0.048 54 3.6 0.0 22 45 168 191 163 199 0.87

5 7 1.9 2.1e+03 -1.5 0.0 22 45 196 219 191 226 0.78

6 7 0.031 35 4.2 0.0 22 46 224 248 218 254 0.85

7 7 0.14 1.5e+02 2.2 0.0 21 44 251 274 247 277 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	1.4	1.5e+03	-1.0	0.0	22	45	84	107	81	110	0.84
2	7	0.0025	2.8	7.7	0.0	21	45	111	135	103	142	0.88
3	7	0.0008	0.91	9.3	0.1	22	45	140	163	135	170	0.88
4	7	0.048	54	3.6	0.0	22	45	168	191	163	199	0.87
5	7	1.9	2.1e+03	-1.5	0.0	22	45	196	219	191	226	0.78
6	7	0.031	35	4.2	0.0	22	46	224	248	218	254	0.85
7	7	0.14	1.5e+02	2.2	0.0	21	44	251	274	247	277	0.89

Coding Sequence: ATGCACCTACAAAATCACAGTAAAGTCTGCCGGATGCGATTTCTatcagaggaggaaaaagaaaagctaAAGCAGAAAAAACTACCTCGGTCGCCAACCCTGAATCTATGCTCGTTCGACGTGTGCGTTGTCTGCAATTCAAGAGTCTTACCTTGCGGCACAGCTCAGAAGACTAGCAAGAAATGCGACAACTGCGTGTTCAAGGATGAGGAGAGTGTCTTGCTCCCTATGAAGAATGTTGGTGACAAAAATAGACCGTTCTCTTGTACTTATTGTGATAAGAAATTCACCAAATCCGGTCATTTAAATGAACATTTAAGGACGCACACGGGCGAAAAGCCGTTCTCGTGCACTTattgtgataaaaaattcaCCCAATCCAGTAATTTAGATACGCATTTAAGGACGCACACGGGCGACAGGCCGTTCTCTTGTACTTATTGTGATAAGAAATTCACCCAATCCAGTAATTTAGATAGGCATCTAAGGACGCACACAGGCGACAGGCCATTCTCGTGCACTTATTGTGTAAAGAAATTCACCAAATCCAGTAATTTAGATACGCATCTAAGGACGCACACAGGCGACAGGCCATTCTCGTGCACTTATTGTGATAAGAAATTCACCATATCCAGTGatttaaatattcatttaaGGACGCACACGGGCGACAAGCCGTTCTCGTGCACTTATTGTGATAAGAAATTCACCAAATCCAGTAATTTAAATGAGCATCTAAGGACGCACACGGGCGAAAAGCCGTTCTCGTGCACTTATTGTGATAAGAAATTCACCACTTCCAGTAATCTTACCACGCATGTAAGGACGCACTCCAACGACTGA
Protein Sequence: MHLQNHSKVCRMRFLSEEEKEKLKQKKLPRSPTLNLCSFDVCVVCNSRVLPCGTAQKTSKKCDNCVFKDEESVLLPMKNVGDKNRPFSCTYCDKKFTKSGHLNEHLRTHTGEKPFSCTYCDKKFTQSSNLDTHLRTHTGDRPFSCTYCDKKFTQSSNLDRHLRTHTGDRPFSCTYCVKKFTKSSNLDTHLRTHTGDRPFSCTYCDKKFTISSDLNIHLRTHTGDKPFSCTYCDKKFTKSSNLNEHLRTHTGEKPFSCTYCDKKFTTSSNLTTHVRTHSND

Sequence clustering based on sequence similarity using MMseqs2