Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.00049 1.2 11.4 0.1 21 48 6 33 2 35 0.89

2 5 0.0024 5.9 9.1 0.4 18 48 32 62 30 64 0.90

3 5 0.00064 1.5 11.0 0.6 18 51 61 94 59 97 0.89

4 5 0.035 83 5.4 0.1 26 51 98 123 92 125 0.85

5 5 0.021 50 6.2 0.2 21 51 122 152 119 154 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.00049	1.2	11.4	0.1	21	48	6	33	2	35	0.89
2	5	0.0024	5.9	9.1	0.4	18	48	32	62	30	64	0.90
3	5	0.00064	1.5	11.0	0.6	18	51	61	94	59	97	0.89
4	5	0.035	83	5.4	0.1	26	51	98	123	92	125	0.85
5	5	0.021	50	6.2	0.2	21	51	122	152	119	154	0.86

Coding Sequence: ATGGCCAGTCATAAAGGTGAGatgcctcatcaatgtcctcactgtgattataaatcagtagaatctggaaatatgaaaagacatgtaatggcccgtcacacaggtgagaagcctcatcaatgtcctcattgcgaTTATAAATCAGTAGAATCTGGAACTATGAAAAGACATATAATAGCCCGTCATGAAGAggagaagcctcatcactgtccTCACTGTAATTACAAATCAGCAcaatctggaaatatgaaaatacatgtaaTGGCCCATCACACTGATAAGAAgtctcatcaatgtcctcactgtgattataaatccgCACGATCTGGAGCTATGAAAAAGCATATAATGGTCCGTCATACAGGaaagaagcctcatcaatgccctcactgtgattataaatcaacagaatatggaaatatgaaaaaacatataatagccCGTCATACAGATAAGAAGCCTCATTGA
Protein Sequence: MASHKGEMPHQCPHCDYKSVESGNMKRHVMARHTGEKPHQCPHCDYKSVESGTMKRHIIARHEEEKPHHCPHCNYKSAQSGNMKIHVMAHHTDKKSHQCPHCDYKSARSGAMKKHIMVRHTGKKPHQCPHCDYKSTEYGNMKKHIIARHTDKKPH

Sequence clustering based on sequence similarity using MMseqs2