Acus000431.1
Basic Information
- Insect
- Arma custos
- Gene Symbol
- -
- Assembly
- GCA_037127475.1
- Location
- CM073759.1:6616295-6616762[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.00049 1.2 11.4 0.1 21 48 6 33 2 35 0.89 2 5 0.0024 5.9 9.1 0.4 18 48 32 62 30 64 0.90 3 5 0.00064 1.5 11.0 0.6 18 51 61 94 59 97 0.89 4 5 0.035 83 5.4 0.1 26 51 98 123 92 125 0.85 5 5 0.021 50 6.2 0.2 21 51 122 152 119 154 0.86
Sequence Information
- Coding Sequence
- ATGGCCAGTCATAAAGGTGAGatgcctcatcaatgtcctcactgtgattataaatcagtagaatctggaaatatgaaaagacatgtaatggcccgtcacacaggtgagaagcctcatcaatgtcctcattgcgaTTATAAATCAGTAGAATCTGGAACTATGAAAAGACATATAATAGCCCGTCATGAAGAggagaagcctcatcactgtccTCACTGTAATTACAAATCAGCAcaatctggaaatatgaaaatacatgtaaTGGCCCATCACACTGATAAGAAgtctcatcaatgtcctcactgtgattataaatccgCACGATCTGGAGCTATGAAAAAGCATATAATGGTCCGTCATACAGGaaagaagcctcatcaatgccctcactgtgattataaatcaacagaatatggaaatatgaaaaaacatataatagccCGTCATACAGATAAGAAGCCTCATTGA
- Protein Sequence
- MASHKGEMPHQCPHCDYKSVESGNMKRHVMARHTGEKPHQCPHCDYKSVESGTMKRHIIARHEEEKPHHCPHCNYKSAQSGNMKIHVMAHHTDKKSHQCPHCDYKSARSGAMKKHIMVRHTGKKPHQCPHCDYKSTEYGNMKKHIIARHTDKKPH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00165733;
- 90% Identity
- iTF_00165616;
- 80% Identity
- iTF_00165616;