Basic Information

Insect: Arma custos
Gene Symbol: -
Assembly: GCA_037127475.1
Location: CM073759.1:5170714-5171802[-]

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 12 0.00068 1.6 10.9 0.3 21 49 6 34 3 38 0.90

2 12 0.058 1.4e+02 4.7 0.3 21 48 35 62 32 64 0.88

3 12 0.0015 3.7 9.8 0.3 18 49 61 92 57 96 0.90

4 12 0.04 97 5.2 0.3 18 48 90 120 88 124 0.89

5 12 0.047 1.1e+02 5.0 0.3 18 48 119 149 115 151 0.89

6 12 0.0018 4.4 9.5 0.2 17 49 147 179 138 183 0.89

7 12 0.11 2.7e+02 3.8 0.4 18 44 177 203 175 208 0.82

8 12 0.1 2.4e+02 4.0 0.4 21 49 209 237 204 241 0.88

9 12 0.014 34 6.7 0.4 18 49 235 266 233 271 0.89

10 12 0.062 1.5e+02 4.6 0.3 18 48 264 294 263 296 0.89

11 12 0.00038 0.9 11.7 0.3 17 48 292 323 284 325 0.91

12 12 0.0025 6.1 9.1 0.8 19 48 323 352 322 356 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	12	0.00068	1.6	10.9	0.3	21	49	6	34	3	38	0.90
2	12	0.058	1.4e+02	4.7	0.3	21	48	35	62	32	64	0.88
3	12	0.0015	3.7	9.8	0.3	18	49	61	92	57	96	0.90
4	12	0.04	97	5.2	0.3	18	48	90	120	88	124	0.89
5	12	0.047	1.1e+02	5.0	0.3	18	48	119	149	115	151	0.89
6	12	0.0018	4.4	9.5	0.2	17	49	147	179	138	183	0.89
7	12	0.11	2.7e+02	3.8	0.4	18	44	177	203	175	208	0.82
8	12	0.1	2.4e+02	4.0	0.4	21	49	209	237	204	241	0.88
9	12	0.014	34	6.7	0.4	18	49	235	266	233	271	0.89
10	12	0.062	1.5e+02	4.6	0.3	18	48	264	294	263	296	0.89
11	12	0.00038	0.9	11.7	0.3	17	48	292	323	284	325	0.91
12	12	0.0025	6.1	9.1	0.8	19	48	323	352	322	356	0.91

Sequence Information

Coding Sequence: ATGGCctgtcatacaggtgagaagcctcatcactgtcctcactgtcattataaatcagcacaatcTGGAGATATGAAAAGACATGTGATGGTCcatcatacaggtgagaagcctcatcaatgtcctcagtgtgattataaatcagtgaACTCTGCAACTATGAAAAAACATGTTATGGCCCggcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagcacaatcTGGAACTATGAAAAAACATGTTATGGCCCggcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcagaaTCTGGACACATGAAAAATcatgtaatggcccgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcagaaTCTGGAGCTATGAAAAATcatgtaatggcccgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcacaatctggagctatgaaaaatcatataatggcccgtcataccggtgagaagcctcatcaatgtcctcactgtgattataaatcagcacaatctggagctatgaaaatacatgtaatggcctgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcagaaTCTGGACACATGAAAAATcatgtaatggcccgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcagaaTCTGGACACATGAAAAAACATGTTATGGCCCggcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcagaaTCTGGAGCTATGAAAAATcatgtaatggcccgtcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagcacaatcTGGAACTATGAAAAGACATGTTATGGCCCggcatacaggtgagaagcctcatcaatgtcctcactgtgattatacaTCAGCAGAATCTGGAAAGATTAAAAGACATATAATAGTCCGTCATAAAAGGGAGAAACGTCCTCAATGTCCTCTCTAA
Protein Sequence: MACHTGEKPHHCPHCHYKSAQSGDMKRHVMVHHTGEKPHQCPQCDYKSVNSATMKKHVMARHTGEKPHHCPHCDYKSAQSGTMKKHVMARHTGEKPHQCPHCDYKSAESGHMKNHVMARHTGEKPHQCPHCDYKSAESGAMKNHVMARHTGEKPHQCPHCDYKSAQSGAMKNHIMARHTGEKPHQCPHCDYKSAQSGAMKIHVMACHTGEKPHQCPHCDYKSAESGHMKNHVMARHTGEKPHQCPHCDYKSAESGHMKKHVMARHTGEKPHQCPHCDYKSAESGAMKNHVMARHTGEKPHHCPHCDYKSAQSGTMKRHVMARHTGEKPHQCPHCDYTSAESGKIKRHIIVRHKREKRPQCPL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00165740;
90% Identity: iTF_00165517;
80% Identity: iTF_00165517;