Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.00078 1.9 10.7 0.1 17 48 7 38 3 40 0.93

2 10 0.0014 3.3 10.0 0.2 18 49 37 68 35 72 0.90

3 10 0.015 36 6.6 0.2 18 49 66 97 64 101 0.89

4 10 0.0036 8.7 8.6 0.2 18 48 95 125 93 128 0.91

5 10 0.072 1.7e+02 4.4 0.2 18 45 124 151 122 156 0.83

6 10 0.046 1.1e+02 5.0 0.3 20 49 155 184 151 188 0.88

7 10 0.014 33 6.7 0.2 18 46 182 210 176 214 0.86

8 10 0.26 6.2e+02 2.7 0.4 21 45 214 238 210 243 0.83

9 10 0.0082 20 7.5 0.2 21 49 243 271 239 275 0.90

10 10 7.7e-05 0.18 13.9 0.5 18 49 269 300 268 303 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.00078	1.9	10.7	0.1	17	48	7	38	3	40	0.93
2	10	0.0014	3.3	10.0	0.2	18	49	37	68	35	72	0.90
3	10	0.015	36	6.6	0.2	18	49	66	97	64	101	0.89
4	10	0.0036	8.7	8.6	0.2	18	48	95	125	93	128	0.91
5	10	0.072	1.7e+02	4.4	0.2	18	45	124	151	122	156	0.83
6	10	0.046	1.1e+02	5.0	0.3	20	49	155	184	151	188	0.88
7	10	0.014	33	6.7	0.2	18	46	182	210	176	214	0.86
8	10	0.26	6.2e+02	2.7	0.4	21	45	214	238	210	243	0.83
9	10	0.0082	20	7.5	0.2	21	49	243	271	239	275	0.90
10	10	7.7e-05	0.18	13.9	0.5	18	49	269	300	268	303	0.91

Coding Sequence: atgaaaaatcatgtaatggcccgtcataaaggtgagaagcctcatcagtgtcctcactgtgattataaatcagcacaatcTGGAACTATGAAAAAACATGTTATGGCCCggcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcagaaTCTGGAGATATGAAAAGACATGtgatggcccgtcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagcagatTCTGGACacatgaaaaaacattttatggcccggcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcacaatctggagctatgaaaaatcatgtaatggcccgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcacaatctggagctatgaaaatacatataatgGCCTGTCATaaaggtgagaagcctcatcactgtccTCACTGTGACTTTAAATCAGCAAGGTCTGGAGCtattaaaaaacatgtaattgcccgtcatacaggtgagaaacctcatcaatgtcctcactgtgattataaatcagcaaaaTCTGGAGATATGAAAAGACATGTGATGGCctgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcacaatctggacacatgaaaatacatgtaatggcctgtcatacaggtgagaagcctcatcaatgccctcactgtgattataaatcagcacaatctggagctatgaaaaatcatgtaatggcccgtcatacaggtgagaagcctcatcaatgtcctcactgtgattatacaTCAGCAGAATCTGGAAATATAAAAAGGCATATAATAGTCCGTCATACAGGGGAGAAACGTCATCAATGCCCTCTCTAA
Protein Sequence: MKNHVMARHKGEKPHQCPHCDYKSAQSGTMKKHVMARHTGEKPHQCPHCDYKSAESGDMKRHVMARHTGEKPHHCPHCDYKSADSGHMKKHFMARHTGEKPHQCPHCDYKSAQSGAMKNHVMARHTGEKPHQCPHCDYKSAQSGAMKIHIMACHKGEKPHHCPHCDFKSARSGAIKKHVIARHTGEKPHQCPHCDYKSAKSGDMKRHVMACHTGEKPHQCPHCDYKSAQSGHMKIHVMACHTGEKPHQCPHCDYKSAQSGAMKNHVMARHTGEKPHQCPHCDYTSAESGNIKRHIIVRHTGEKRHQCPL

Sequence clustering based on sequence similarity using MMseqs2