Basic Information

Insect: Arma custos
Gene Symbol: -
Assembly: GCA_037127475.1
Location: CM073759.1:12028209-12037066[-]

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 20 0.07 1.7e+02 4.5 0.3 22 49 12 39 9 43 0.87

2 20 0.0023 5.6 9.2 0.5 18 49 37 68 31 73 0.87

3 20 0.094 2.3e+02 4.1 0.4 18 48 66 96 64 100 0.86

4 20 6.6e-05 0.16 14.2 0.1 16 49 93 126 85 132 0.87

5 20 0.0018 4.4 9.5 0.2 21 49 156 184 150 189 0.88

6 20 0.0063 15 7.8 0.3 21 48 214 241 205 244 0.91

7 20 0.0013 3.2 10.0 0.3 20 49 242 271 240 277 0.87

8 20 3.2 7.8e+03 -0.9 0.1 20 51 271 302 269 304 0.81

9 20 0.0031 7.5 8.8 0.4 26 49 306 329 300 333 0.86

10 20 0.18 4.3e+02 3.2 0.4 18 31 327 340 325 357 0.82

11 20 0.12 3e+02 3.7 0.1 24 48 362 386 355 389 0.84

12 20 0.038 91 5.3 0.1 16 48 383 415 380 421 0.83

13 20 0.2 4.9e+02 3.0 0.1 21 48 417 444 413 447 0.81

14 20 0.031 74 5.6 0.6 17 48 442 473 437 475 0.88

15 20 0.0014 3.4 9.9 0.3 18 49 472 503 470 507 0.89

16 20 0.014 33 6.7 0.6 18 51 501 534 499 538 0.87

17 20 0.43 1e+03 1.9 0.1 26 48 542 564 539 568 0.89

18 20 2.6 6.2e+03 -0.6 0.0 26 48 579 601 577 606 0.78

19 20 0.43 1e+03 1.9 0.2 16 48 598 630 591 633 0.81

20 20 0.42 1e+03 2.0 0.4 21 48 632 659 627 662 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	20	0.07	1.7e+02	4.5	0.3	22	49	12	39	9	43	0.87
2	20	0.0023	5.6	9.2	0.5	18	49	37	68	31	73	0.87
3	20	0.094	2.3e+02	4.1	0.4	18	48	66	96	64	100	0.86
4	20	6.6e-05	0.16	14.2	0.1	16	49	93	126	85	132	0.87
5	20	0.0018	4.4	9.5	0.2	21	49	156	184	150	189	0.88
6	20	0.0063	15	7.8	0.3	21	48	214	241	205	244	0.91
7	20	0.0013	3.2	10.0	0.3	20	49	242	271	240	277	0.87
8	20	3.2	7.8e+03	-0.9	0.1	20	51	271	302	269	304	0.81
9	20	0.0031	7.5	8.8	0.4	26	49	306	329	300	333	0.86
10	20	0.18	4.3e+02	3.2	0.4	18	31	327	340	325	357	0.82
11	20	0.12	3e+02	3.7	0.1	24	48	362	386	355	389	0.84
12	20	0.038	91	5.3	0.1	16	48	383	415	380	421	0.83
13	20	0.2	4.9e+02	3.0	0.1	21	48	417	444	413	447	0.81
14	20	0.031	74	5.6	0.6	17	48	442	473	437	475	0.88
15	20	0.0014	3.4	9.9	0.3	18	49	472	503	470	507	0.89
16	20	0.014	33	6.7	0.6	18	51	501	534	499	538	0.87
17	20	0.43	1e+03	1.9	0.1	26	48	542	564	539	568	0.89
18	20	2.6	6.2e+03	-0.6	0.0	26	48	579	601	577	606	0.78
19	20	0.43	1e+03	1.9	0.2	16	48	598	630	591	633	0.81
20	20	0.42	1e+03	2.0	0.4	21	48	632	659	627	662	0.86

Sequence Information

Coding Sequence: ATGAAAAACCATGTAATGGCCCTTCATGCTGGTGAGAAGCCTtttcaatgccctcattgtgattataaatctgtacattCTGGAcatatgaaaaaacatatacaacatcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtaacatctggaaatatgaaaaaacatatacaacgtcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtaacatctggacaaatgaaaaatcatgtcCAAGCTCGTCATTCCGGTGAGAAGCCTtttcaatgtcctcattgtgattataaatctgtaacatctggaaatatgaaaaaacatatacaacttcgtcataccggtgagaagccTTTTCTATGtactcattgtgattataaatctgtaagatctggacaaatgaaaaaccatGTACAAGCttgtcataccggtgagaagccctatcaatgccctcattgtgattataaatccgTAGCATCtggaaatttgaaaaaacatatacaacatcgtcataccggtgagaagccTTTTCAATGtgctcattgtgattataaatctgtaacatctggagcattgaaaaaccatatacaagctcaTCATACGGGTGAGAAGCCTtttcaatgccctcattgtgatcatcaatctgtaacatctggaaatatgaaaaaacatatacaacgtcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtagcatctggaaatttgaaaaaacatatacaacatcgtcataccggtgagaagccTTTTCAATGtactcattgtgattataaatctgtaacatctgtaCAATTGAAATACCATATACAAGCTCATCATACGGGTAAAaagtcctatcaatgccctcattgcgATTATAAATCTACAACATTTAGAAATTTGAAAAGACAtttaatggcccgtcatacaagtgagaagcctcatcaatgtcctcattgtgattataaatctgtggAATCAGGAGCTATGAAAATACACTACATGGCCTGGCACAAAGGTGAGAAGCtatatcaatgccctcattgtgattataaatctgtacaatctggaaatatgaaaaaacatgtaagggcccatcatactggtgagaagccgtttcaatgccctcattgtgattataaatctgtaacatctggaaatatgaaaaaacatgtaatggcccatcatactggtgagaagccttttcaatgccctcattgtgattataaatctataaaatctGGAGATGTGAAAAACcatgtaatggcccgtcatactggtgagaagcctttccaatgccctcattgtgattataaatctgtacattCTGGAcatatgaaaaaacatatacaacatcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatttgtaacatctggaaatatgaaaaaacatatacaacgtcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtaacatctggagaaatgaaaaatcatgtacaagctcgtcatactgctcgtcataccggtgtgaagtcctatcaatgccctcattgtgattataaatctgtacaaTCTGGAcatatgaaaaaccatatacaagctcgtcataccgGTTCCAAAAATAGTTGCCATAAACTTCTGAAGTCTCATCAATGTCcttattgtgattataaatctgtaagatCTGGACAAATTAAAGATCATGTACAAtctcgtcataccggtgagaagtccaaccaatgccctcattgtgattataagtcaGTACAATTAGGGAATATGAATAGTCATATAATGGCCCATCATACCAGCGTGAGGCCTtttcaatgccctcattgtgattataaatctgcaAGATCTGGAAGCATAAAAAACCATGTGCAAGCTCGTCATACCAAGTTATTAAAGAAGGTTGAAGAAAACACAAGAGACCAGAACGGCTGCAAACTTTGGCACGAATTAAGATTTGGTAGAATAATGGCCTCCAAAGCTTATGAAGTTAAAACATGTAAAACAAGTGATGGTGCTTTggtatag
Protein Sequence: MKNHVMALHAGEKPFQCPHCDYKSVHSGHMKKHIQHRHTGEKPFQCPHCDYKSVTSGNMKKHIQRRHTGEKPFQCPHCDYKSVTSGQMKNHVQARHSGEKPFQCPHCDYKSVTSGNMKKHIQLRHTGEKPFLCTHCDYKSVRSGQMKNHVQACHTGEKPYQCPHCDYKSVASGNLKKHIQHRHTGEKPFQCAHCDYKSVTSGALKNHIQAHHTGEKPFQCPHCDHQSVTSGNMKKHIQRRHTGEKPFQCPHCDYKSVASGNLKKHIQHRHTGEKPFQCTHCDYKSVTSVQLKYHIQAHHTGKKSYQCPHCDYKSTTFRNLKRHLMARHTSEKPHQCPHCDYKSVESGAMKIHYMAWHKGEKLYQCPHCDYKSVQSGNMKKHVRAHHTGEKPFQCPHCDYKSVTSGNMKKHVMAHHTGEKPFQCPHCDYKSIKSGDVKNHVMARHTGEKPFQCPHCDYKSVHSGHMKKHIQHRHTGEKPFQCPHCDYKFVTSGNMKKHIQRRHTGEKPFQCPHCDYKSVTSGEMKNHVQARHTARHTGVKSYQCPHCDYKSVQSGHMKNHIQARHTGSKNSCHKLLKSHQCPYCDYKSVRSGQIKDHVQSRHTGEKSNQCPHCDYKSVQLGNMNSHIMAHHTSVRPFQCPHCDYKSARSGSIKNHVQARHTKLLKKVEENTRDQNGCKLWHELRFGRIMASKAYEVKTCKTSDGALV

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00165379;
90% Identity: iTF_00165379;
80% Identity: iTF_00165379;