Basic Information

Insect: Arma custos
Gene Symbol: -
Assembly: GCA_037127475.1
Location: CM073759.1:12176111-12177739[+]

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 17 0.072 1.7e+02 4.4 0.2 21 48 11 38 8 40 0.89

2 17 0.003 7.3 8.8 0.4 18 49 37 68 35 73 0.87

3 17 0.21 5e+02 3.0 0.3 21 48 69 96 67 98 0.87

4 17 8.2e-06 0.02 17.1 0.3 16 49 93 126 89 130 0.89

5 17 0.0018 4.3 9.6 0.2 22 49 128 155 126 160 0.88

6 17 0.018 43 6.4 0.3 21 49 185 213 173 217 0.89

7 17 0.00089 2.1 10.5 0.5 18 49 211 242 210 247 0.87

8 17 4.3 1e+04 -1.2 0.0 22 51 244 273 242 276 0.82

9 17 0.065 1.6e+02 4.6 0.4 26 49 277 300 269 305 0.83

10 17 0.54 1.3e+03 1.6 0.5 20 31 300 311 297 328 0.81

11 17 0.12 2.8e+02 3.7 0.0 24 46 333 355 327 359 0.83

12 17 0.0062 15 7.8 0.1 21 48 359 386 356 388 0.89

13 17 0.043 1e+02 5.1 0.1 19 48 386 415 383 420 0.82

14 17 0.11 2.7e+02 3.8 0.1 21 49 417 445 413 449 0.81

15 17 0.021 51 6.1 0.6 17 48 442 473 438 476 0.88

16 17 0.001 2.4 10.4 0.3 18 49 472 503 470 507 0.89

17 17 0.075 1.8e+02 4.4 0.1 20 48 503 531 501 535 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	17	0.072	1.7e+02	4.4	0.2	21	48	11	38	8	40	0.89
2	17	0.003	7.3	8.8	0.4	18	49	37	68	35	73	0.87
3	17	0.21	5e+02	3.0	0.3	21	48	69	96	67	98	0.87
4	17	8.2e-06	0.02	17.1	0.3	16	49	93	126	89	130	0.89
5	17	0.0018	4.3	9.6	0.2	22	49	128	155	126	160	0.88
6	17	0.018	43	6.4	0.3	21	49	185	213	173	217	0.89
7	17	0.00089	2.1	10.5	0.5	18	49	211	242	210	247	0.87
8	17	4.3	1e+04	-1.2	0.0	22	51	244	273	242	276	0.82
9	17	0.065	1.6e+02	4.6	0.4	26	49	277	300	269	305	0.83
10	17	0.54	1.3e+03	1.6	0.5	20	31	300	311	297	328	0.81
11	17	0.12	2.8e+02	3.7	0.0	24	46	333	355	327	359	0.83
12	17	0.0062	15	7.8	0.1	21	48	359	386	356	388	0.89
13	17	0.043	1e+02	5.1	0.1	19	48	386	415	383	420	0.82
14	17	0.11	2.7e+02	3.8	0.1	21	49	417	445	413	449	0.81
15	17	0.021	51	6.1	0.6	17	48	442	473	438	476	0.88
16	17	0.001	2.4	10.4	0.3	18	49	472	503	470	507	0.89
17	17	0.075	1.8e+02	4.4	0.1	20	48	503	531	501	535	0.86

Sequence Information

Coding Sequence: ATGAAAAACCATGTAATGGCCCTtcatactggtgagaagccttttcaatgccctcattgtgattataaatctgtacattCTGGAcatatgaaaaaacatatacaacatcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtaacatctggaaatgtgaaaaaacatatacaacgtcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtaacatctggacaaatgaaaaatcatgtaCAAGCTCGTCATTCCAGTGAGAAGCCTtttcaatgtcctcattgtgattataaatctgtaacatctggaaatatgaaaaaacatatacaacttcgtcataccggtgagaagccctatcaatgccctcattgtgattataaatctgtagcatctggaaatttgaaaaaacatatacaacatcgtcataccggtgagaagccTTTTCAATGtactcattgtgattataaatctgtaacatctggagcattgaaaaaccatatacaagctcaTCATACGGGTGAGAAGCCTtttcaatgccctcattgtgatcatcaatctgtaacatctggaaatatgaaaatacatatacaacgtcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtagcatctggaaatttgaaaaaacatatacaacatcgtcataccggtgagaagccTTTTCAATGtactcattgtgattataaatctgtaacatctgtaCAATTGAAATACCATATACAAGCTCATCATACGGGTAAAaagtcctatcaatgccctcattgtgattataaatctacaACATTTAGAAATTTGAAAAGACATGTAATGGCCCATCATAcaagtgagaagcctcatcaatgtcctcattgtgattataaatctgtggAATCAGGAGCTATGAAAATACACTACATGGCCTGGCACAAAGGTGAGAAGCTatatcaatgtcctcattgtgatcaTAAATCAACACAATCTGGAAATTTGAAAACACATGTAATGGCCTATCATACTGGAGAGAAGCCTtttcaatgccctcattgtgattataaatctgtacaatctggaaatatgaaaaaacatgtaagggcccatcatactggtgagaagccgtttcaatgccctcattgtgattataaatctgtaacatctggaaatatgaaaaaacatgtaatggcccatcatactggtgagaagccttttcaatgccctcattgtgattataaatctataaaatctGGAGATGTGAAAAACcatgtaatggcccgtcatactggtgagaagccttttcaatgccctcattgtgattataaatctgtacattCTGGAcatatgaaaaaacatatacaacatcgtcatactggtgagaagccttttcaatgtcctcattgtgattataaatttgtaacatctggaaatatgaaaaaacatatacaacgtcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtaacatctggagaaatgaaaaatcatgtacaagctcgtcatactggtgagaagtccttatcaatgccctcattgtga
Protein Sequence: MKNHVMALHTGEKPFQCPHCDYKSVHSGHMKKHIQHRHTGEKPFQCPHCDYKSVTSGNVKKHIQRRHTGEKPFQCPHCDYKSVTSGQMKNHVQARHSSEKPFQCPHCDYKSVTSGNMKKHIQLRHTGEKPYQCPHCDYKSVASGNLKKHIQHRHTGEKPFQCTHCDYKSVTSGALKNHIQAHHTGEKPFQCPHCDHQSVTSGNMKIHIQRRHTGEKPFQCPHCDYKSVASGNLKKHIQHRHTGEKPFQCTHCDYKSVTSVQLKYHIQAHHTGKKSYQCPHCDYKSTTFRNLKRHVMAHHTSEKPHQCPHCDYKSVESGAMKIHYMAWHKGEKLYQCPHCDHKSTQSGNLKTHVMAYHTGEKPFQCPHCDYKSVQSGNMKKHVRAHHTGEKPFQCPHCDYKSVTSGNMKKHVMAHHTGEKPFQCPHCDYKSIKSGDVKNHVMARHTGEKPFQCPHCDYKSVHSGHMKKHIQHRHTGEKPFQCPHCDYKFVTSGNMKKHIQRRHTGEKPFQCPHCDYKSVTSGEMKNHVQARHTGEKSLSMPSL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00165380;
90% Identity: iTF_00165380;
80% Identity: iTF_00165380;