Basic Information

Insect: Arma custos
Gene Symbol: -
Assembly: GCA_037127475.1
Location: CM073759.1:12176111-12177739[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 18 0.0071 1.5 11.4 8.4 1 23 15 38 15 38 0.96

2 18 4.8e-05 0.01 18.2 2.2 1 23 44 67 44 67 0.98

3 18 0.00051 0.11 15.0 1.3 1 23 73 96 73 96 0.95

4 18 5.1e-05 0.011 18.2 2.0 1 23 102 125 102 125 0.96

5 18 0.00025 0.055 16.0 3.0 1 23 131 154 131 154 0.96

6 18 0.00013 0.029 16.8 2.7 1 23 160 182 160 183 0.96

7 18 0.00047 0.1 15.1 2.8 1 23 189 212 189 212 0.98

8 18 0.00037 0.08 15.4 3.1 1 23 218 241 218 241 0.96

9 18 0.00085 0.18 14.3 4.1 1 23 247 269 247 270 0.96

10 18 0.00012 0.026 17.0 4.9 1 23 276 298 276 299 0.95

11 18 0.015 3.3 10.4 0.7 1 23 305 328 305 328 0.94

12 18 7e-05 0.015 17.7 2.8 1 23 334 357 334 357 0.95

13 18 8.2e-05 0.018 17.5 3.3 1 23 363 385 363 386 0.96

14 18 0.00016 0.034 16.6 2.8 1 23 392 414 392 415 0.95

15 18 0.0034 0.73 12.4 0.8 1 23 421 444 421 444 0.94

16 18 0.0071 1.5 11.4 8.4 1 23 450 473 450 473 0.96

17 18 1.2e-06 0.00025 23.3 3.2 1 23 479 502 479 502 0.98

18 18 0.0006 0.13 14.8 1.0 1 23 508 531 508 531 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	18	0.0071	1.5	11.4	8.4	1	23	15	38	15	38	0.96
2	18	4.8e-05	0.01	18.2	2.2	1	23	44	67	44	67	0.98
3	18	0.00051	0.11	15.0	1.3	1	23	73	96	73	96	0.95
4	18	5.1e-05	0.011	18.2	2.0	1	23	102	125	102	125	0.96
5	18	0.00025	0.055	16.0	3.0	1	23	131	154	131	154	0.96
6	18	0.00013	0.029	16.8	2.7	1	23	160	182	160	183	0.96
7	18	0.00047	0.1	15.1	2.8	1	23	189	212	189	212	0.98
8	18	0.00037	0.08	15.4	3.1	1	23	218	241	218	241	0.96
9	18	0.00085	0.18	14.3	4.1	1	23	247	269	247	270	0.96
10	18	0.00012	0.026	17.0	4.9	1	23	276	298	276	299	0.95
11	18	0.015	3.3	10.4	0.7	1	23	305	328	305	328	0.94
12	18	7e-05	0.015	17.7	2.8	1	23	334	357	334	357	0.95
13	18	8.2e-05	0.018	17.5	3.3	1	23	363	385	363	386	0.96
14	18	0.00016	0.034	16.6	2.8	1	23	392	414	392	415	0.95
15	18	0.0034	0.73	12.4	0.8	1	23	421	444	421	444	0.94
16	18	0.0071	1.5	11.4	8.4	1	23	450	473	450	473	0.96
17	18	1.2e-06	0.00025	23.3	3.2	1	23	479	502	479	502	0.98
18	18	0.0006	0.13	14.8	1.0	1	23	508	531	508	531	0.95

Sequence Information

Coding Sequence: ATGAAAAACCATGTAATGGCCCTtcatactggtgagaagccttttcaatgccctcattgtgattataaatctgtacattCTGGAcatatgaaaaaacatatacaacatcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtaacatctggaaatgtgaaaaaacatatacaacgtcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtaacatctggacaaatgaaaaatcatgtaCAAGCTCGTCATTCCAGTGAGAAGCCTtttcaatgtcctcattgtgattataaatctgtaacatctggaaatatgaaaaaacatatacaacttcgtcataccggtgagaagccctatcaatgccctcattgtgattataaatctgtagcatctggaaatttgaaaaaacatatacaacatcgtcataccggtgagaagccTTTTCAATGtactcattgtgattataaatctgtaacatctggagcattgaaaaaccatatacaagctcaTCATACGGGTGAGAAGCCTtttcaatgccctcattgtgatcatcaatctgtaacatctggaaatatgaaaatacatatacaacgtcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtagcatctggaaatttgaaaaaacatatacaacatcgtcataccggtgagaagccTTTTCAATGtactcattgtgattataaatctgtaacatctgtaCAATTGAAATACCATATACAAGCTCATCATACGGGTAAAaagtcctatcaatgccctcattgtgattataaatctacaACATTTAGAAATTTGAAAAGACATGTAATGGCCCATCATAcaagtgagaagcctcatcaatgtcctcattgtgattataaatctgtggAATCAGGAGCTATGAAAATACACTACATGGCCTGGCACAAAGGTGAGAAGCTatatcaatgtcctcattgtgatcaTAAATCAACACAATCTGGAAATTTGAAAACACATGTAATGGCCTATCATACTGGAGAGAAGCCTtttcaatgccctcattgtgattataaatctgtacaatctggaaatatgaaaaaacatgtaagggcccatcatactggtgagaagccgtttcaatgccctcattgtgattataaatctgtaacatctggaaatatgaaaaaacatgtaatggcccatcatactggtgagaagccttttcaatgccctcattgtgattataaatctataaaatctGGAGATGTGAAAAACcatgtaatggcccgtcatactggtgagaagccttttcaatgccctcattgtgattataaatctgtacattCTGGAcatatgaaaaaacatatacaacatcgtcatactggtgagaagccttttcaatgtcctcattgtgattataaatttgtaacatctggaaatatgaaaaaacatatacaacgtcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtaacatctggagaaatgaaaaatcatgtacaagctcgtcatactggtgagaagtccttatcaatgccctcattgtga
Protein Sequence: MKNHVMALHTGEKPFQCPHCDYKSVHSGHMKKHIQHRHTGEKPFQCPHCDYKSVTSGNVKKHIQRRHTGEKPFQCPHCDYKSVTSGQMKNHVQARHSSEKPFQCPHCDYKSVTSGNMKKHIQLRHTGEKPYQCPHCDYKSVASGNLKKHIQHRHTGEKPFQCTHCDYKSVTSGALKNHIQAHHTGEKPFQCPHCDHQSVTSGNMKIHIQRRHTGEKPFQCPHCDYKSVASGNLKKHIQHRHTGEKPFQCTHCDYKSVTSVQLKYHIQAHHTGKKSYQCPHCDYKSTTFRNLKRHVMAHHTSEKPHQCPHCDYKSVESGAMKIHYMAWHKGEKLYQCPHCDHKSTQSGNLKTHVMAYHTGEKPFQCPHCDYKSVQSGNMKKHVRAHHTGEKPFQCPHCDYKSVTSGNMKKHVMAHHTGEKPFQCPHCDYKSIKSGDVKNHVMARHTGEKPFQCPHCDYKSVHSGHMKKHIQHRHTGEKPFQCPHCDYKFVTSGNMKKHIQRRHTGEKPFQCPHCDYKSVTSGEMKNHVQARHTGEKSLSMPSL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00165720;
90% Identity: iTF_00165720;
80% Identity: iTF_00165720;