Abis011608.1
Basic Information
- Insect
- Argynnis bischoffii
- Gene Symbol
- gprs
- Assembly
- GCA_033884665.1
- Location
- CM066620.1:5379650-5383859[+]
Transcription Factor Domain
- TF Family
- BTB
- Domain
- zf-C2H2|ZBTB
- PFAM
- PF00651
- TF Group
- Zinc-Coordinating Group
- Description
- The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 1.2e-09 4.8e-07 30.6 0.0 9 45 36 73 28 91 0.84 2 3 9.8e-06 0.004 18.0 0.0 45 79 122 155 107 161 0.73 3 3 0.12 47 4.9 0.0 54 77 168 190 157 191 0.81
Sequence Information
- Coding Sequence
- ATGCGAAGCGGAGCGCTAGTAGCAATGGAGGCCGAGCCCGACCTCAGCACTTTCGAAAATAAATCAGGACTCGCTGAAGATATGAAATTTCTTGCTTCTATGCCTGAGTTGTGCGATGTCACTTTTTTAGTAGGGGACACAAGGGAACCAGTGTGTGCTGTGAAAGCTGTCCTTGCAGCGAGAAGCAGggtttttcaaaaaatgctcTACCAAGCACCAAGCCCTCAAAGAAAGAAGGAACCAGCTCCACGAGAGAACAAACTAAGACTATTCTTGAAGAGATCGTCTGAGCCTTTATTAAATCTCCAAAATGCTGCCCAACAgAGATCAGCTTTCGCGCAGCAATTGGCTCCAATTCAAGAGCCTTCCTCTCAACAACACCAGACACTCATAATCGAAGAATTTGAACCTGATGTATTTCGACAGCTtattgaatatatacatactggATGTGTTACCCTCCAACCCAGAACACTCTTAGGACGCAATCGTAAAATCAATTTACCAGAGCAAATAGACGTATCGATCTTTGGAATATTACTGTCGAGTGTTTACGAGGAAAAGTGTAATCTTTAA
- Protein Sequence
- MRSGALVAMEAEPDLSTFENKSGLAEDMKFLASMPELCDVTFLVGDTREPVCAVKAVLAARSRVFQKMLYQAPSPQRKKEPAPRENKLRLFLKRSSEPLLNLQNAAQQRSAFAQQLAPIQEPSSQQHQTLIIEEFEPDVFRQLIEYIHTGCVTLQPRTLLGRNRKINLPEQIDVSIFGILLSSVYEEKCNL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00836751;
- 90% Identity
- iTF_00013245;
- 80% Identity
- -