Aste004519.1
Basic Information
- Insect
- Anopheles stephensi
- Gene Symbol
- -
- Assembly
- GCA_013141755.1
- Location
- CM023249.1:19019635-19023709[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.0058 30 4.6 0.1 19 49 14 44 11 47 0.85 2 7 0.00016 0.81 9.6 0.0 21 50 44 73 42 75 0.87 3 7 0.0023 12 5.9 0.0 21 47 72 98 69 103 0.84 4 7 0.00044 2.2 8.2 0.0 21 46 100 125 97 130 0.90 5 7 0.003 15 5.6 0.1 23 49 134 160 129 163 0.86 6 7 0.00038 1.9 8.4 0.0 21 52 160 191 158 192 0.88 7 7 0.00031 1.6 8.7 0.1 21 46 188 213 185 224 0.87
Sequence Information
- Coding Sequence
- ATGTCACAGCAGGCGCTGGAAAGTACGGGTGTGAAAATTTCCAACTGCTCGAAACCGTTCGCCTGCACCGAATGCAATAAGCTGTTTCGCCAACTGAGCACACTGACCAACCACATGAAGATACACACGGGCGAAAAACCGTACAAGTGCACGATCTGTCTGAAGGAGTTCCGCCAAACGACCACACTTTCGAACCACATGAAAATTCATACGGGTGAAAAGCCCTTCACCTGTAACTTTTGCGACAAACAGTTCCGCCAGCTAAGCACGCTGTCCAACCACAAGAAAATACACACCGGAGAAAAGCCATTCGAATGTTCGGTTTGCGGCAAACAGTTCCGTCAGTCCAGCACGCTCAACAGCCATATCCGGATTCATTCGGATGATAAATTTTGCATAAAACCCTTCAAATGCAGCATCTGTCCGAAGGAGTTCCGCCAGACGACGACCCTAGCGAATCACATCAAAATTCACACTGGTGAAAAGCCGTACGCTTGCACGTACTGTAGCAAAACCTTTCGCCAGACGGGCACACTTTCGAACCATCTGAAGATACACACCGGCGAGAAGCCGTTCGAGTGTTCGGTTTGTGGCAAACAGTTCCGGCAGTCCAGCACCTTGAACAGCCACATTCGGATCCATGCGGACGATAAGTATTGCAAACCTTCACAAACGGAACAGCGGTCCATTGTGACGCTAAACGGTGGACTGGCGTTAAAAGATGAGGACGTGAAACCGTTCTTTGCCATGATGTAA
- Protein Sequence
- MSQQALESTGVKISNCSKPFACTECNKLFRQLSTLTNHMKIHTGEKPYKCTICLKEFRQTTTLSNHMKIHTGEKPFTCNFCDKQFRQLSTLSNHKKIHTGEKPFECSVCGKQFRQSSTLNSHIRIHSDDKFCIKPFKCSICPKEFRQTTTLANHIKIHTGEKPYACTYCSKTFRQTGTLSNHLKIHTGEKPFECSVCGKQFRQSSTLNSHIRIHADDKYCKPSQTEQRSIVTLNGGLALKDEDVKPFFAMM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01462352;
- 90% Identity
- iTF_00102067;
- 80% Identity
- iTF_00108548;