Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.015 68 3.7 0.0 23 52 18 47 14 48 0.86

2 7 0.00018 0.81 9.8 0.0 21 52 44 75 40 76 0.88

3 7 0.042 1.8e+02 2.3 0.0 21 44 72 95 70 99 0.86

4 7 0.00046 2 8.6 0.1 21 46 100 125 93 133 0.90

5 7 0.003 13 5.9 0.1 23 52 134 163 127 165 0.88

6 7 0.00082 3.6 7.8 0.0 21 51 160 190 157 191 0.88

7 7 0.00042 1.8 8.7 0.2 21 46 188 213 186 218 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.015	68	3.7	0.0	23	52	18	47	14	48	0.86
2	7	0.00018	0.81	9.8	0.0	21	52	44	75	40	76	0.88
3	7	0.042	1.8e+02	2.3	0.0	21	44	72	95	70	99	0.86
4	7	0.00046	2	8.6	0.1	21	46	100	125	93	133	0.90
5	7	0.003	13	5.9	0.1	23	52	134	163	127	165	0.88
6	7	0.00082	3.6	7.8	0.0	21	51	160	190	157	191	0.88
7	7	0.00042	1.8	8.7	0.2	21	46	188	213	186	218	0.90

Coding Sequence: ATGTCACAGCAGGCGGTGGAAAGTGCTGGCATGAAAATTCCCAACTGCTCGAAACCGTTCGCGTGCACCGAATGCAACAAATTGTTTCGTCAGCTGAGCACACTGACCAACCACATGAAAATCCACACCGGCGAAAAACCGTACAAGTGTAACATCTGCCTGAAGGAGTTCCGCCAGACGACGACACTGTCGAACCATATGAAAATTCATACAGGCGAAAAACCCTTCAGTTGTAATTTCTGCGATAAGCAGTTCCGGCAGCTGAGTACCCTCTCGAACCACAAGAAAATACACACCGGTGAAAAACCATTCGAATGTTCGGTGTGTGGCAAACAGTTTCGGCAGTCCAGCACACTCAACAGTCACATCCGGATTCATTCGgatgataaattttGCATAAAACCCTTCAAATGCAGCATCTGTCCGAAGGAGTTCCGCCAGACGACGACCCTAGCGAATCACATAAAAATCCACACCGGTGAAAAACCGTACGCGTGTTCGTACTGCGGCAAAACCTTTCGTCAGACGGGAACCCTGTCGAACCATCTGAAGATTCACACCGGCGAAAAGCCATTCGAATGCTCGGTCTGTCGCAAACAGTTCCGGCAGTCGAGCACCCTTAACAGCCACATTCGAATCCACGCTGACGACAAGTATTGCAAATCCTCTCCTACGGCTGATCAACGGTCGATCATGGCGGTTAACGGTGGGCTTAACATAAAAGATGAGGACGTCAAACCCTTTTTTATGATGTAA
Protein Sequence: MSQQAVESAGMKIPNCSKPFACTECNKLFRQLSTLTNHMKIHTGEKPYKCNICLKEFRQTTTLSNHMKIHTGEKPFSCNFCDKQFRQLSTLSNHKKIHTGEKPFECSVCGKQFRQSSTLNSHIRIHSDDKFCIKPFKCSICPKEFRQTTTLANHIKIHTGEKPYACSYCGKTFRQTGTLSNHLKIHTGEKPFECSVCRKQFRQSSTLNSHIRIHADDKYCKSSPTADQRSIMAVNGGLNIKDEDVKPFFMM

Sequence clustering based on sequence similarity using MMseqs2