Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.013 50 3.5 0.1 19 46 14 41 11 43 0.88

2 7 0.00013 0.52 9.9 0.0 21 52 44 75 42 77 0.88

3 7 0.022 87 2.8 0.0 21 47 72 98 68 103 0.84

4 7 0.00037 1.5 8.4 0.0 21 46 100 125 95 132 0.90

5 7 0.0059 23 4.6 0.0 23 46 134 157 127 160 0.90

6 7 0.00043 1.7 8.3 0.0 21 51 160 190 158 191 0.88

7 7 0.00033 1.3 8.6 0.1 21 46 188 213 186 224 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.013	50	3.5	0.1	19	46	14	41	11	43	0.88
2	7	0.00013	0.52	9.9	0.0	21	52	44	75	42	77	0.88
3	7	0.022	87	2.8	0.0	21	47	72	98	68	103	0.84
4	7	0.00037	1.5	8.4	0.0	21	46	100	125	95	132	0.90
5	7	0.0059	23	4.6	0.0	23	46	134	157	127	160	0.90
6	7	0.00043	1.7	8.3	0.0	21	51	160	190	158	191	0.88
7	7	0.00033	1.3	8.6	0.1	21	46	188	213	186	224	0.86

Coding Sequence: ATGTCACAGCAGGCGGTGGAGGGTGCTGGTATGAAAATTTCCAACTGCTCGAAAccgttcgcgtgcaccgaatgcaacaaattgtttcgccagctgagcacgctgaccaaccacatgaaaatacacacgggcgaaaagccgtacaagtgcACGATCTGTCTGAAGGAGTTCCGCCAAACGACAACGCTTTCGAACCACATGAAAATTCATACAGGTGAAAAGCCCTTCAACTGTAACTTTTGCGACAAGCAGTTCCGTCAGCTGAGCACGCTTTCGAACCACAAGAAAATACACACCGGTGAAAAACCATTTGAATGTTCGGTGTGCGGCAAACAGTTCCGGCAGTCCAGCACGCTCAACAGCCACATCCGGATTCATTCGGATGATAAATTTTGCATAAAACCCTTCAAATGCAGCATCTGTCCGAAGGAGTTCCGGCAGACGACGACCCTAGCGAATCACATAAAAATCCACACAGgtgaaaagccgtacgcctgcacgtactgcagcaaaacctttcgccagacgggtacgctttcgaaccatctgaagatacacaccggggaaaagccgttcgagtgctcggtgtgcggtaaacagttccggcagtccagtaccttgaacagccacattcgaatccacgctgacgaCAAGTATTGCAAACCATCCCAAACGGAACAACGCTCCATTGTGGCGCTAAACGGTGGACTTAATTTAAAAGACGAGGACGTCAAACCTTTCTTTGCCATGATGTAA
Protein Sequence: MSQQAVEGAGMKISNCSKPFACTECNKLFRQLSTLTNHMKIHTGEKPYKCTICLKEFRQTTTLSNHMKIHTGEKPFNCNFCDKQFRQLSTLSNHKKIHTGEKPFECSVCGKQFRQSSTLNSHIRIHSDDKFCIKPFKCSICPKEFRQTTTLANHIKIHTGEKPYACTYCSKTFRQTGTLSNHLKIHTGEKPFECSVCGKQFRQSSTLNSHIRIHADDKYCKPSQTEQRSIVALNGGLNLKDEDVKPFFAMM

Sequence clustering based on sequence similarity using MMseqs2