Afus013116.1
Basic Information
- Insect
- Anania fuscalis
- Gene Symbol
- slp2
- Assembly
- GCA_950371115.1
- Location
- OX493331.1:589886-590833[-]
Transcription Factor Domain
- TF Family
- Fork_head
- Domain
- Fork_head domain
- PFAM
- PF00250
- TF Group
- Helix-turn-helix
- Description
- The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.5e-42 4.7e-39 133.4 0.1 1 87 69 154 69 155 0.97 2 2 9.9 1.9e+04 -3.1 0.0 3 11 192 200 191 202 0.88
Sequence Information
- Coding Sequence
- ATGGTGAAGTTTGAAGGAGACTTCAGTATTAACTCAATACTGATGAACCACGCGGTGAACAAGCCGCCGCTCTCGCCGGCGCCGTCATCCACCGAGGCGTCGCACTCCGAGCCAGACCTCAGCGACTCCGAGCTCGACGTCACGGGCACCGAGCCCGTCGACTGCACCAAACCCAAGGAAGACGACAAAAAGGACAAGAAACACGAGAAACCCGCCTACAGCTACAACGCCCTCATCATGATGGCCATCCGCAACAGCCCCGAGAAACGACTCACGCTCAACGGAATCTACGAGTACATCATGACCAACTTCCCCTACTACAGAGAAAATAGGCAAGGCTGGCAGAACTCTATTCGACACAATTTGAGCTTGAACAAGTGCTTCGTGAAAGTGCCGCGGCATTACGACGACCCGGGCAAAGGCAACTACTGGATGCTGGACGCTTCGGCCGAGGACGTATTCATCGGTGGAACAACAGGGAAGCTCCGCAGACGATCAGCATTGAACGGGCGATCACGGCTGGCGTGTTTCAAGCGGCCACTGTTCCCCGGTGCTCCCCTGCCCGGCGCATATCCCCCGACGACGTACTCGCAGCTCGTCGGACTCTACTCCCAGCTGCTCTACCAGAGATACGCTCCGATGCAGATGAAGACTCCTCCGGTTGCACCGAGTGCGATGCACCCCGCGTTCCGGGGTGCCGAGGCGATGCCCTACGGCCTGCCGTATTCGCCGGCGATGTACGGCGCCGAGCGAATGCCGCCGGCGTTCCTCAGCCAGCCGATGCTGCAGAGCTCGATGCAGTCGGCTCTGATGGCGCAGAGCTCACCTCCGCTGGGCGCGCACTCGCCGCCCACGTCTGGCGCGTCCAGCCCTGAGCTGCCCTCGCCCTCGCACCACCCTCTCACTCCTCACATCTACAAGCCCGTCACGGTGCTCTCCCGGCAGTGA
- Protein Sequence
- MVKFEGDFSINSILMNHAVNKPPLSPAPSSTEASHSEPDLSDSELDVTGTEPVDCTKPKEDDKKDKKHEKPAYSYNALIMMAIRNSPEKRLTLNGIYEYIMTNFPYYRENRQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDASAEDVFIGGTTGKLRRRSALNGRSRLACFKRPLFPGAPLPGAYPPTTYSQLVGLYSQLLYQRYAPMQMKTPPVAPSAMHPAFRGAEAMPYGLPYSPAMYGAERMPPAFLSQPMLQSSMQSALMAQSSPPLGAHSPPTSGASSPELPSPSHHPLTPHIYKPVTVLSRQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00790047;
- 90% Identity
- iTF_01125251;
- 80% Identity
- -