Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.32 7.7e+03 -2.9 1.5 11 14 13 16 11 18 0.67

2 6 0.094 2.3e+03 -1.2 2.1 12 15 32 35 31 36 0.93

3 6 0.32 7.7e+03 -2.9 0.2 13 17 39 43 39 46 0.72

4 6 7.2e-10 1.7e-05 24.7 2.9 4 21 52 69 50 70 0.87

5 6 0.63 1.5e+04 -3.8 6.9 10 15 81 86 80 87 0.83

6 6 1 2.4e+04 -5.3 1.3 6 9 91 94 90 94 0.72

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.32	7.7e+03	-2.9	1.5	11	14	13	16	11	18	0.67
2	6	0.094	2.3e+03	-1.2	2.1	12	15	32	35	31	36	0.93
3	6	0.32	7.7e+03	-2.9	0.2	13	17	39	43	39	46	0.72
4	6	7.2e-10	1.7e-05	24.7	2.9	4	21	52	69	50	70	0.87
5	6	0.63	1.5e+04	-3.8	6.9	10	15	81	86	80	87	0.83
6	6	1	2.4e+04	-5.3	1.3	6	9	91	94	90	94	0.72

Coding Sequence: ATGTCTGATGACGGATCTACGACAGTGGAGAAGAAAGGGCGCGGGAGACAAAAGGCAAATGGCACACAATCTGAGGCTAAAGAAGTCAAGAAAAGAGGGAGACCGCCGGCGGCTGGCAAACCTAAGGAATCTGCAAAATCATCAGATGATGAACAAGCGCCGGTAGCAAAAAGAGGCAGAGGCAGGCCTAAGGGATCAAAGAAAAAGACTATTGGCAAGGGAAAGGGTGGCTCAGAAGGTAGGGGCCGTGGAAGGCCACGCAAAGATGCTCCCCCACCCAAAAAAGATGCTGCCTCCACTGAAGAAGAACAAGATGACTATGAAGAAGATGAGGGTTCTGAAGACCAATAG
Protein Sequence: MSDDGSTTVEKKGRGRQKANGTQSEAKEVKKRGRPPAAGKPKESAKSSDDEQAPVAKRGRGRPKGSKKKTIGKGKGGSEGRGRGRPRKDAPPPKKDAASTEEEQDDYEEDEGSEDQ

Sequence clustering based on sequence similarity using MMseqs2