Amal020925.1
Basic Information
- Insect
- Agrilus mali
- Gene Symbol
- -
- Assembly
- GCA_029378335.1
- Location
- CM055660.1:10543068-10544207[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.01 1.9e+02 3.3 0.2 26 43 52 70 44 76 0.69 2 5 0.0087 1.6e+02 3.5 0.0 22 52 78 108 72 110 0.82 3 5 0.00067 12 7.1 0.1 22 46 106 130 101 132 0.89 4 5 3e-05 0.55 11.4 0.1 21 47 133 159 130 163 0.91 5 5 0.00038 7.2 7.8 0.0 21 48 161 188 159 191 0.90
Sequence Information
- Coding Sequence
- ATGAAAATGTGCCCTAATTATCTTCATCATTTTAACTATGtacagaaaaatattaataggtCTGCGAGAGAAACTGTAAGACTGGTATCAAAAAATGAAGTGAACCAAGCTGAGATAAATCATTTACTCAAAAGAAAATCAATGCCATTAGAAATGTGCcctatttgtaaaaaatacttcaggaGAATGAAGACTCATTTACAAAAGCACGAGGATGTTAAACCTGATCCAAATGATCCACTTACTTGCCAGTTTTGTATGAAAAGTTTTAATACAGGCAGTAACTTAAGTATACATATGCGCACACATACAGGAGATAAACCTTATGTTTGTGAAGTTTGTCTTAAAGGCTTCGCACAGTCGTGCAATCTTGTGAATCACATGAGGATTCACACAGGGGAAAGGCCTTATAAATGTCCCCATTGTGACCGGGCTTTCACTCAATCAGGGAATTTGAGCAATCACATAAGACTTCATACCGACGAAAAGCCGTTCAAATGTCATTTTTGTGACAAAGCATTTACACAGTCAGGTAATTTAAATTCTCACATAAGAAATAATCATAAATTTGTAAACGTACAAATGGGTTAA
- Protein Sequence
- MKMCPNYLHHFNYVQKNINRSARETVRLVSKNEVNQAEINHLLKRKSMPLEMCPICKKYFRRMKTHLQKHEDVKPDPNDPLTCQFCMKSFNTGSNLSIHMRTHTGDKPYVCEVCLKGFAQSCNLVNHMRIHTGERPYKCPHCDRAFTQSGNLSNHIRLHTDEKPFKCHFCDKAFTQSGNLNSHIRNNHKFVNVQMG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00030671;
- 90% Identity
- iTF_00030671;
- 80% Identity
- iTF_00032358;