Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.01 1.9e+02 3.3 0.2 26 43 52 70 44 76 0.69

2 5 0.0087 1.6e+02 3.5 0.0 22 52 78 108 72 110 0.82

3 5 0.00067 12 7.1 0.1 22 46 106 130 101 132 0.89

4 5 3e-05 0.55 11.4 0.1 21 47 133 159 130 163 0.91

5 5 0.00038 7.2 7.8 0.0 21 48 161 188 159 191 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.01	1.9e+02	3.3	0.2	26	43	52	70	44	76	0.69
2	5	0.0087	1.6e+02	3.5	0.0	22	52	78	108	72	110	0.82
3	5	0.00067	12	7.1	0.1	22	46	106	130	101	132	0.89
4	5	3e-05	0.55	11.4	0.1	21	47	133	159	130	163	0.91
5	5	0.00038	7.2	7.8	0.0	21	48	161	188	159	191	0.90

Coding Sequence: ATGAAAATGTGCCCTAATTATCTTCATCATTTTAACTATGtacagaaaaatattaataggtCTGCGAGAGAAACTGTAAGACTGGTATCAAAAAATGAAGTGAACCAAGCTGAGATAAATCATTTACTCAAAAGAAAATCAATGCCATTAGAAATGTGCcctatttgtaaaaaatacttcaggaGAATGAAGACTCATTTACAAAAGCACGAGGATGTTAAACCTGATCCAAATGATCCACTTACTTGCCAGTTTTGTATGAAAAGTTTTAATACAGGCAGTAACTTAAGTATACATATGCGCACACATACAGGAGATAAACCTTATGTTTGTGAAGTTTGTCTTAAAGGCTTCGCACAGTCGTGCAATCTTGTGAATCACATGAGGATTCACACAGGGGAAAGGCCTTATAAATGTCCCCATTGTGACCGGGCTTTCACTCAATCAGGGAATTTGAGCAATCACATAAGACTTCATACCGACGAAAAGCCGTTCAAATGTCATTTTTGTGACAAAGCATTTACACAGTCAGGTAATTTAAATTCTCACATAAGAAATAATCATAAATTTGTAAACGTACAAATGGGTTAA
Protein Sequence: MKMCPNYLHHFNYVQKNINRSARETVRLVSKNEVNQAEINHLLKRKSMPLEMCPICKKYFRRMKTHLQKHEDVKPDPNDPLTCQFCMKSFNTGSNLSIHMRTHTGDKPYVCEVCLKGFAQSCNLVNHMRIHTGERPYKCPHCDRAFTQSGNLSNHIRLHTDEKPFKCHFCDKAFTQSGNLNSHIRNNHKFVNVQMG

Sequence clustering based on sequence similarity using MMseqs2