Basic Information

Gene Symbol
-
Assembly
GCA_963921985.1
Location
OY998124.1:22460227-22461624[+]

Transcription Factor Domain

TF Family
zf-GAGA
Domain
zf-GAGA domain
PFAM
PF09237
TF Group
Zinc-Coordinating Group
Description
Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 5 0.018 1.3e+02 3.0 0.2 26 43 53 71 46 77 0.70
2 5 0.012 89 3.6 0.0 22 52 79 109 70 111 0.83
3 5 0.001 7.3 7.1 0.1 22 46 107 131 102 133 0.89
4 5 2.6e-05 0.19 12.2 0.2 21 52 134 165 130 165 0.88
5 5 0.00058 4.2 7.8 0.0 21 48 162 189 160 192 0.90

Sequence Information

Coding Sequence
ATGAAAATGTGTCCTAATTATCTTCATCATTTTAACTATAATGTacagaaaaatattaatagatcTGCAAGAGAAACTGTAAGACTGGTATCAAAAGATGAAGTGaaccaaacagaaataaatcACTTACTTAAAAGAAAATCACTGCCATTAGAAATGTGTCCCATTTGTAAAAAATACTTCAGGAGAATGAAGACTCATTTACAAAAGCACGAGGATGTTAAACCTGATCCTAATGATCCACTTACTTGTCAGTTTTGTATGAAGAGTTTTAATACAGGCAGTAACCTAAGTATACACATGCGTACACACACAGGAGATAAACCTTATGTGTGTGAAGTGTGTCTTAAAGGATTTGCACAGTCTTGTAATCTCGTGAATCACATGAGGATTCACACAGGGGAAAGGCCGTACAAATGTCCCCATTGTGACCGAGCTTTCACACAATCAGGAAATTTGAGCAATCACGTAAGACTTCATACCGACGAAAAGCCGTTTAAATGTCACTTTTGTGACAAAGCTTTTACACAATCAGGTAATTTAAATTCTCACATAAGGAATAATCATAAATTTGTAAGCGTACAGGTGGGTTAA
Protein Sequence
MKMCPNYLHHFNYNVQKNINRSARETVRLVSKDEVNQTEINHLLKRKSLPLEMCPICKKYFRRMKTHLQKHEDVKPDPNDPLTCQFCMKSFNTGSNLSIHMRTHTGDKPYVCEVCLKGFAQSCNLVNHMRIHTGERPYKCPHCDRAFTQSGNLSNHVRLHTDEKPFKCHFCDKAFTQSGNLNSHIRNNHKFVSVQVG

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2