Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.018 1.3e+02 3.0 0.2 26 43 53 71 46 77 0.70

2 5 0.012 89 3.6 0.0 22 52 79 109 70 111 0.83

3 5 0.001 7.3 7.1 0.1 22 46 107 131 102 133 0.89

4 5 2.6e-05 0.19 12.2 0.2 21 52 134 165 130 165 0.88

5 5 0.00058 4.2 7.8 0.0 21 48 162 189 160 192 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.018	1.3e+02	3.0	0.2	26	43	53	71	46	77	0.70
2	5	0.012	89	3.6	0.0	22	52	79	109	70	111	0.83
3	5	0.001	7.3	7.1	0.1	22	46	107	131	102	133	0.89
4	5	2.6e-05	0.19	12.2	0.2	21	52	134	165	130	165	0.88
5	5	0.00058	4.2	7.8	0.0	21	48	162	189	160	192	0.90

Coding Sequence: ATGAAAATGTGTCCTAATTATCTTCATCATTTTAACTATAATGTacagaaaaatattaatagatcTGCAAGAGAAACTGTAAGACTGGTATCAAAAGATGAAGTGaaccaaacagaaataaatcACTTACTTAAAAGAAAATCACTGCCATTAGAAATGTGTCCCATTTGTAAAAAATACTTCAGGAGAATGAAGACTCATTTACAAAAGCACGAGGATGTTAAACCTGATCCTAATGATCCACTTACTTGTCAGTTTTGTATGAAGAGTTTTAATACAGGCAGTAACCTAAGTATACACATGCGTACACACACAGGAGATAAACCTTATGTGTGTGAAGTGTGTCTTAAAGGATTTGCACAGTCTTGTAATCTCGTGAATCACATGAGGATTCACACAGGGGAAAGGCCGTACAAATGTCCCCATTGTGACCGAGCTTTCACACAATCAGGAAATTTGAGCAATCACGTAAGACTTCATACCGACGAAAAGCCGTTTAAATGTCACTTTTGTGACAAAGCTTTTACACAATCAGGTAATTTAAATTCTCACATAAGGAATAATCATAAATTTGTAAGCGTACAGGTGGGTTAA
Protein Sequence: MKMCPNYLHHFNYNVQKNINRSARETVRLVSKDEVNQTEINHLLKRKSLPLEMCPICKKYFRRMKTHLQKHEDVKPDPNDPLTCQFCMKSFNTGSNLSIHMRTHTGDKPYVCEVCLKGFAQSCNLVNHMRIHTGERPYKCPHCDRAFTQSGNLSNHVRLHTDEKPFKCHFCDKAFTQSGNLNSHIRNNHKFVSVQVG

Sequence clustering based on sequence similarity using MMseqs2