Apsi013416.1
Basic Information
- Insect
- Acronicta psi
- Gene Symbol
- litaf
- Assembly
- GCA_946251945.1
- Location
- CAMIUM010000048.1:1071061-1071919[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.3e-22 2.9e-19 69.2 14.3 2 68 97 167 96 169 0.87
Sequence Information
- Coding Sequence
- ATGGCAAGTAATCCAGGACCAGGCGCAATGGCTTCAGCGCCTGAAGATCTTCCTCCACCATACTCAGCTGTAGTGGGTAATCCACAATACGGCTTCGTTGCTCCTGGAGGCGAACCATATACTGCTGTGGGTGGCCCGTATCCGCAGCCTAAGCAGTTTACAGCGCCGGGAGTGTACCCGCACCCGAGTATCACTGTGACGAACACTCAGCCGCAAGCAGGTGATATGCTGCCGCCTCAACCTCCAAGTGTACCCGTGGGGATAGTTCTCCCGCCTGCAGTCGGCACTGAACCAACTACAATAACTTGTTTTAATTGCGGCAAAGTTGTGACAACAAGAGTTACATACACTACAGCCTGGCATACTCATCTAGTAGCTGGATCTGTATGTGTAATTACTATGGTTTGCTCTCTTTGCTGTCTGGGCCTTGTTCCATACTGCTTTGATACATTCAAGGATGCTGAACACTACTGCCCCAATTGCAACACTTTTATAGGAAAAAGTAGCAAGTGCTAA
- Protein Sequence
- MASNPGPGAMASAPEDLPPPYSAVVGNPQYGFVAPGGEPYTAVGGPYPQPKQFTAPGVYPHPSITVTNTQPQAGDMLPPQPPSVPVGIVLPPAVGTEPTTITCFNCGKVVTTRVTYTTAWHTHLVAGSVCVITMVCSLCCLGLVPYCFDTFKDAEHYCPNCNTFIGKSSKC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00172408;
- 90% Identity
- iTF_01378056; iTF_00072398; iTF_01539285; iTF_00017852; iTF_00952385; iTF_00851364; iTF_00974309; iTF_00772556; iTF_00953201; iTF_01339617; iTF_00785698; iTF_01526690; iTF_01527947; iTF_00071983; iTF_00758833; iTF_00148153; iTF_01231236; iTF_00300837; iTF_00446789; iTF_00445783; iTF_01028889; iTF_00852357; iTF_01117927; iTF_00112195; iTF_01119912; iTF_01118910; iTF_00122024; iTF_01095529; iTF_00123018; iTF_00426026; iTF_01095530; iTF_01093711; iTF_01094583; iTF_00364587; iTF_01286096; iTF_01027922; iTF_00124854; iTF_01031638; iTF_01440662; iTF_01029817; iTF_01026969; iTF_01340827; iTF_00831804; iTF_00925406; iTF_00123903; iTF_01084809; iTF_01085978; iTF_00177752; iTF_00301772; iTF_00784876; iTF_00784068; iTF_00121072; iTF_01247731; iTF_01425649; iTF_01193298; iTF_00450675; iTF_01342675; iTF_00384245; iTF_00050491; iTF_01260670;
- 80% Identity
- -