Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.3 7.6e+02 0.5 0.0 26 46 7 27 4 31 0.84

2 6 2.9 7.5e+03 -2.7 0.0 21 31 40 50 37 56 0.79

3 6 5.3e-07 0.0014 18.9 0.1 13 44 102 133 96 138 0.92

4 6 0.0017 4.4 7.7 0.3 26 47 171 191 155 198 0.85

5 6 0.14 3.5e+02 1.6 0.0 21 44 222 245 212 250 0.86

6 6 0.0017 4.4 7.7 0.1 20 46 277 303 262 311 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.3	7.6e+02	0.5	0.0	26	46	7	27	4	31	0.84
2	6	2.9	7.5e+03	-2.7	0.0	21	31	40	50	37	56	0.79
3	6	5.3e-07	0.0014	18.9	0.1	13	44	102	133	96	138	0.92
4	6	0.0017	4.4	7.7	0.3	26	47	171	191	155	198	0.85
5	6	0.14	3.5e+02	1.6	0.0	21	44	222	245	212	250	0.86
6	6	0.0017	4.4	7.7	0.1	20	46	277	303	262	311	0.84

Coding Sequence: ATGGCAGGAACCACAGTAGGGTGCAAAATTTgctcaaaacaaataaaacaagaaccttCCCTAAGCAACGACTTAACTCTACAACCGAACTCATCAACCCTCGCGGAATTGAGCATCGACGAGAACCCGGTCGCTTGCAATAAATGTAAGATCGAAATCGACGAGGCTTACGAAATCTTCACGCAAAatgaaaacgatttaaaaactgaatCGCTTCCAAGTCCTCATTATTCGTACAAAGAAGAGTTTATAGAGGGTGCGGGTACGTCTCGATTCAACACGAAAAACATGCATAAAAATGacgaaaatattaaatcaagAACGGACAtggaaaaaccatttaaatgtacTATTTGTAATTATTGCTGTGGACAATCGCGAACCTTAAGAAACCATTTCTACAAACATCCTGGCGAGTTGCTTTACACGTGTGTTAAGTGCGACTACAAGTGTTCCAACAATACCGATCTGGCTCGCCACAAAAAAACTCACGCTAAAGACAAAcggtttaaatgtaaattttgtgattATGCGTGCGCACAATCGGGAAATTTAAAAAGACATTTGTACAGACATTCGGACGAGTGGCCTTACAGATGCGATAAGTGCGattataaatgttcaaatattgGTAATATGTCTCGTCACAAATTAACGCACactaaagaaaaaccgtttaaatgcgaGTCGTGCGATTTTTCGACTGGATATTTGCGAAACTTAAAAATGCATCTGCCCAGACACTCTGGCGATTGGCGTTACCGATGCGATATATGCGACTATAAATGTTCTCACAGAACTTCGTTGACTCGTCACAAACGGACCCACACTAAAGAGTATCCGTTTAAATGTAAGTTTTGCGATTATTCGTGTGCGCAATCGGGAAACTTAAAAACCCATTTGTATATACATTCTGGCGAGCGGCCTTATTGGTGCGATAAGTGCGAATATAAAACTAGTACGAGAACGTTATTGATTCGgcatttgaaaaatcatttcgATAACACGAATGATGAAAAGTGA
Protein Sequence: MAGTTVGCKICSKQIKQEPSLSNDLTLQPNSSTLAELSIDENPVACNKCKIEIDEAYEIFTQNENDLKTESLPSPHYSYKEEFIEGAGTSRFNTKNMHKNDENIKSRTDMEKPFKCTICNYCCGQSRTLRNHFYKHPGELLYTCVKCDYKCSNNTDLARHKKTHAKDKRFKCKFCDYACAQSGNLKRHLYRHSDEWPYRCDKCDYKCSNIGNMSRHKLTHTKEKPFKCESCDFSTGYLRNLKMHLPRHSGDWRYRCDICDYKCSHRTSLTRHKRTHTKEYPFKCKFCDYSCAQSGNLKTHLYIHSGERPYWCDKCEYKTSTRTLLIRHLKNHFDNTNDEK

Sequence clustering based on sequence similarity using MMseqs2