Basic Information

Insect: Abscondita terminalis
Gene Symbol: -
Assembly: GCA_013368085.1
Location: JABVZW010002556.1:227806-228878[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.038 1.9 9.3 8.5 1 23 114 136 114 136 0.97

2 8 0.00011 0.0056 17.3 4.3 1 23 142 164 142 164 0.99

3 8 3.7e-05 0.0019 18.8 3.9 1 23 170 192 170 192 0.98

4 8 0.00091 0.046 14.4 3.8 1 23 198 220 198 220 0.99

5 8 0.065 3.3 8.5 1.0 1 20 226 245 226 248 0.93

6 8 5.1e-05 0.0026 18.3 7.7 1 23 254 276 254 276 0.99

7 8 5e-05 0.0026 18.3 3.5 1 23 282 304 282 304 0.97

8 8 0.0011 0.058 14.1 1.2 3 23 312 332 310 332 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.038	1.9	9.3	8.5	1	23	114	136	114	136	0.97
2	8	0.00011	0.0056	17.3	4.3	1	23	142	164	142	164	0.99
3	8	3.7e-05	0.0019	18.8	3.9	1	23	170	192	170	192	0.98
4	8	0.00091	0.046	14.4	3.8	1	23	198	220	198	220	0.99
5	8	0.065	3.3	8.5	1.0	1	20	226	245	226	248	0.93
6	8	5.1e-05	0.0026	18.3	7.7	1	23	254	276	254	276	0.99
7	8	5e-05	0.0026	18.3	3.5	1	23	282	304	282	304	0.97
8	8	0.0011	0.058	14.1	1.2	3	23	312	332	310	332	0.98

Sequence Information

Coding Sequence: ATGGCAGGAACCACAGTAGGGTGCAAAATTTgctcaaaacaaataaaacaagaaccttCCCTAAGCAACGACTTAACTCTACAACCGAACTCATCAACCCTCGCGGAATTGAGCATCGACGAGAACCCGGTCGCTTGCAATAAATGTAAGATCGAAATCGACGAGGCTTACGAAATCTTCACGCAAAatgaaaacgatttaaaaactgaatCGCTTCCAAGTCCTCATTATTCGTACAAAGAAGAGTTTATAGAGGGTGCGGGTACGTCTCGATTCAACACGAAAAACATGCATAAAAATGacgaaaatattaaatcaagAACGGACAtggaaaaaccatttaaatgtacTATTTGTAATTATTGCTGTGGACAATCGCGAACCTTAAGAAACCATTTCTACAAACATCCTGGCGAGTTGCTTTACACGTGTGTTAAGTGCGACTACAAGTGTTCCAACAATACCGATCTGGCTCGCCACAAAAAAACTCACGCTAAAGACAAAcggtttaaatgtaaattttgtgattATGCGTGCGCACAATCGGGAAATTTAAAAAGACATTTGTACAGACATTCGGACGAGTGGCCTTACAGATGCGATAAGTGCGattataaatgttcaaatattgGTAATATGTCTCGTCACAAATTAACGCACactaaagaaaaaccgtttaaatgcgaGTCGTGCGATTTTTCGACTGGATATTTGCGAAACTTAAAAATGCATCTGCCCAGACACTCTGGCGATTGGCGTTACCGATGCGATATATGCGACTATAAATGTTCTCACAGAACTTCGTTGACTCGTCACAAACGGACCCACACTAAAGAGTATCCGTTTAAATGTAAGTTTTGCGATTATTCGTGTGCGCAATCGGGAAACTTAAAAACCCATTTGTATATACATTCTGGCGAGCGGCCTTATTGGTGCGATAAGTGCGAATATAAAACTAGTACGAGAACGTTATTGATTCGgcatttgaaaaatcatttcgATAACACGAATGATGAAAAGTGA
Protein Sequence: MAGTTVGCKICSKQIKQEPSLSNDLTLQPNSSTLAELSIDENPVACNKCKIEIDEAYEIFTQNENDLKTESLPSPHYSYKEEFIEGAGTSRFNTKNMHKNDENIKSRTDMEKPFKCTICNYCCGQSRTLRNHFYKHPGELLYTCVKCDYKCSNNTDLARHKKTHAKDKRFKCKFCDYACAQSGNLKRHLYRHSDEWPYRCDKCDYKCSNIGNMSRHKLTHTKEKPFKCESCDFSTGYLRNLKMHLPRHSGDWRYRCDICDYKCSHRTSLTRHKRTHTKEYPFKCKFCDYSCAQSGNLKTHLYIHSGERPYWCDKCEYKTSTRTLLIRHLKNHFDNTNDEK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00004338;
90% Identity: iTF_00004338;
80% Identity: iTF_00004338;