Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 7.7e-05 0.17 12.1 4.0 5 13 34 42 32 43 0.89

2 3 7.7e-05 0.17 12.1 4.0 5 13 84 92 82 93 0.89

3 3 7.7e-05 0.17 12.1 4.0 5 13 134 142 132 143 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	7.7e-05	0.17	12.1	4.0	5	13	34	42	32	43	0.89
2	3	7.7e-05	0.17	12.1	4.0	5	13	84	92	82	93	0.89
3	3	7.7e-05	0.17	12.1	4.0	5	13	134	142	132	143	0.89

Coding Sequence: ATGCCGGGCGCGGCGTCGGATGAAATCGACGGCGCCGCACCCGAGCATTCCGGCCCTTCTCCCGGCCACGGTTTTTACGCCGCGACCCGCCTCAGCCGCGCCCCCACGCCAAAGCGCCCGAGAGGCACGGCCTACCCGTCCCGGTGCCGCATGCCGGGCGCGGCGTCGGATGAAATCGACGGCGCCGCACCCGAACATTCCGGCCCTTCTCCCGGCCACGGTTTTTACGCCGCGACCCGCCTCAGCCGCGCCCCCACGCCAAAGCGCCCGAGAGGCACGGCCTACCCGTCCCGGTGCCGCATGCCGGGCGCGGCGTCGGATGAAATCGACGGCGCCGCACCCGAACATTCCGGCCCTTCTCCCGGCCACGGTTTTTACGCCGCGACCCGCCTCAGCCGCGCCCCCACGCCAAAGCGCCCGAGAGGCACGGCCTACGCTCCCCTCTCCCGGCCACGGTTTTTTACGCCGCGGCCCACCTCAGTTGCACCCCCACGCCAAAGCGCCCGAGAGGCGCAACCTACCCGCTGGCCCTTCTCAGCGCCGCACTCACCGGCATTCCGGCCCGCCTCAGGGTTCCTCTTGGCTTCACCGTGGGTGGACAGTACCCACGGCTACTAA
Protein Sequence: MPGAASDEIDGAAPEHSGPSPGHGFYAATRLSRAPTPKRPRGTAYPSRCRMPGAASDEIDGAAPEHSGPSPGHGFYAATRLSRAPTPKRPRGTAYPSRCRMPGAASDEIDGAAPEHSGPSPGHGFYAATRLSRAPTPKRPRGTAYAPLSRPRFFTPRPTSVAPPRQSAREAQPTRWPFSAPHSPAFRPASGFLLASPWVDSTHGY

Sequence clustering based on sequence similarity using MMseqs2