Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.059 6.2e+02 1.8 0.3 26 37 119 130 108 142 0.72

2 5 0.097 1e+03 1.1 0.0 22 44 145 167 136 170 0.79

3 5 0.00019 2 9.8 0.2 22 46 173 197 168 199 0.89

4 5 3.2e-05 0.33 12.3 0.1 21 52 200 231 197 232 0.89

5 5 0.0018 19 6.7 0.0 21 48 228 255 226 259 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.059	6.2e+02	1.8	0.3	26	37	119	130	108	142	0.72
2	5	0.097	1e+03	1.1	0.0	22	44	145	167	136	170	0.79
3	5	0.00019	2	9.8	0.2	22	46	173	197	168	199	0.89
4	5	3.2e-05	0.33	12.3	0.1	21	52	200	231	197	232	0.89
5	5	0.0018	19	6.7	0.0	21	48	228	255	226	259	0.89

Coding Sequence: ATGGAAAATGCCCAAGAAAGGGATTTTCACAGAAGTTTGGAGCCTGACGTGATCATTAATCATGTGTCCAGTGAAGATGAAGATGAAAAGTGCGTTAAAAGAAAACAGTCCTGCACATCTTCCCTCAACGGTATTCATTCAAAAATGGTGCCACCAGACATATCTATAATTCCTTTAAGTAAAAAACCTCAAATCAAAATAAGACTCTTCGATAAAGAATATTCGCCTTCAAAGGACGACATCAAAGTACAAAGTTTTTCTCGATCTCCTCGACAAACGGTAAGACTGGTCTCAAAAGACGAAGCGGAACGTGCTGGTGATACTTACGCCCGACGTAAATCCCTTCCTCTCGAAAAATGTCCTATTTGTAAAAAATATTTTCGTCGAATGAAAACTCATTTGCTAAAACACGAGCAAATCAGCAAAAATCCTGATGATCCCTTGACAtgtacgttttgcatgaaagggttcaatactcaaagtaatttgctcattcacatgagaacccatacaggggataaaccatatatttgtgaaatttgtcataaaggttttgcacagtcctgcaacctcgtcaatcatttgagaattcatacaggagaaaggccctttaaatgtcctcactgcgatagggcctttactcagtcgggtaacctaaataaccatataagacttcatacggacgaaaaaccttttaagtgtcatttttgcgataaagcgtttgtgcagtctgggaatcttaactcacatattagaaATAATCATAAATTTTCTGAGGACGTGGGAAATGAGAGCAGTGATAGAGTGGATGGTTTAAAATGCTAG
Protein Sequence: MENAQERDFHRSLEPDVIINHVSSEDEDEKCVKRKQSCTSSLNGIHSKMVPPDISIIPLSKKPQIKIRLFDKEYSPSKDDIKVQSFSRSPRQTVRLVSKDEAERAGDTYARRKSLPLEKCPICKKYFRRMKTHLLKHEQISKNPDDPLTCTFCMKGFNTQSNLLIHMRTHTGDKPYICEICHKGFAQSCNLVNHLRIHTGERPFKCPHCDRAFTQSGNLNNHIRLHTDEKPFKCHFCDKAFVQSGNLNSHIRNNHKFSEDVGNESSDRVDGLKC

Sequence clustering based on sequence similarity using MMseqs2