Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.072 1.2e+02 2.3 0.0 18 46 45 74 31 76 0.79

2 7 0.0025 4.2 7.0 0.1 21 44 77 100 74 105 0.83

3 7 0.49 8e+02 -0.3 0.0 22 46 106 130 102 132 0.81

4 7 0.011 18 4.9 0.1 21 43 133 155 115 159 0.81

5 7 0.00044 0.73 9.4 0.0 18 43 159 183 153 188 0.83

6 7 0.11 1.8e+02 1.8 0.0 21 46 189 214 185 217 0.84

7 7 0.00017 0.28 10.7 0.1 21 47 217 243 214 249 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.072	1.2e+02	2.3	0.0	18	46	45	74	31	76	0.79
2	7	0.0025	4.2	7.0	0.1	21	44	77	100	74	105	0.83
3	7	0.49	8e+02	-0.3	0.0	22	46	106	130	102	132	0.81
4	7	0.011	18	4.9	0.1	21	43	133	155	115	159	0.81
5	7	0.00044	0.73	9.4	0.0	18	43	159	183	153	188	0.83
6	7	0.11	1.8e+02	1.8	0.0	21	46	189	214	185	217	0.84
7	7	0.00017	0.28	10.7	0.1	21	47	217	243	214	249	0.87

Coding Sequence: ATGTGTCATAAATCATTCACTTGTCAAACTACACTGAAGAATCATCAACACATTCACAATGAGGACCGTCCATATTCCTGTATTGTGTGTAATAAGTCATTCACGAGTAAAGGTAGTTTGAAGATACATCACCGTGTACATAGTGGAGAGcgtccatattcctgtgatttGTGTAATGGGTCATTTAGTCATATGAGTATTCTTAAGAATCATCTACACATGCACAGTGGGGAGCGGCCATATTTatgtgatgtatgtaacaaaacattcactCGACAGAGTAATCTGAAGAGACATCAGGTTATGCACAGTGGAGAAAGGCAATATTCGTGTGGTGTGTGTAAGAAGTCATTTTTTGAGAACAGCACTTTGAAGAAACATCTACGCATCCACAGTGGGGAGCGGCCCTATACCTGTGATCtatgtaacaaaacattcactCTACAGTGTAATCTGAAGGAACATCAGCGTACACACAGTTCAGAAAGGCCATTtacctgtgatgtatgtaacaaaacattcactCTACAAGGTAATCTGAAGAAACATCATTATAAGCACAGTGGAGAAAGGCCATATTCCTGTGGTGTGTGTAAAAAGTCATTTTTTGAGAAGGGCGCTTTGAAGGAACATCTATGCCTGCACAGTGGGGAGCGGCCCTAtacctgtgatgtatgtaacaaaacattcactTTCCAGAGTAATCTGAAGAGACATCAGCATTTGCACAATGGAGAAAGGCCATTTTCCTGTGATGTCTAA
Protein Sequence: MCHKSFTCQTTLKNHQHIHNEDRPYSCIVCNKSFTSKGSLKIHHRVHSGERPYSCDLCNGSFSHMSILKNHLHMHSGERPYLCDVCNKTFTRQSNLKRHQVMHSGERQYSCGVCKKSFFENSTLKKHLRIHSGERPYTCDLCNKTFTLQCNLKEHQRTHSSERPFTCDVCNKTFTLQGNLKKHHYKHSGERPYSCGVCKKSFFEKGALKEHLCLHSGERPYTCDVCNKTFTFQSNLKRHQHLHNGERPFSCDV

Sequence clustering based on sequence similarity using MMseqs2