Zimm009999.1
Basic Information
- Insect
- Zonitis immaculata
- Gene Symbol
- Bgb_1
- Assembly
- GCA_037414775.1
- Location
- JAZBGX010004233.1:1-3954[-]
Transcription Factor Domain
- TF Family
- CBF
- Domain
- CBF_beta domain
- PFAM
- PF02312
- TF Group
- Beta-Scaffold Factors
- Description
- Core binding factor (CBF) is a heterodimeric transcription factor essential for genetic regulation of hematopoiesis and osteogenesis. The beta subunit enhances DNA-binding ability of the alpha subunit in vitro, and has been show to have a structure related to the OB fold [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.9e-48 4.3e-44 149.8 0.5 1 93 34 122 34 122 0.95
Sequence Information
- Coding Sequence
- atgCATTCGATGAATGATCCAGCTTCGGCTTTGGCTGGAATGTTACCATTTGACTCGATAGGTCTTTATGAACAACCGAAACCacgatttatattcaaaatgcCAAGAGTTGTGCCGGATCAAAAGGCTAAATTCGAATCGGACGAATTATTTAGAAGGCTCAGTCGGGAGAGTGAGgTCCGTTATACCGGATATCGAGATCGTCCACAAGAAGAACGTCAAGTACGTTTCCAAAATGCCTGCCGTGAAGGACATACAGAAATTGCATTTGCAGCAACTGGTACAAATCTACAATTGGTATTTCAACCACCAACATCTGGTTATATGCCCGATAAAGAATGTGATTTTGAAAAGGAACAAGGCAAA
- Protein Sequence
- MHSMNDPASALAGMLPFDSIGLYEQPKPRFIFKMPRVVPDQKAKFESDELFRRLSRESEVRYTGYRDRPQEERQVRFQNACREGHTEIAFAATGTNLQLVFQPPTSGYMPDKECDFEKEQGK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00423504;
- 90% Identity
- iTF_00029953; iTF_00031554; iTF_00641154; iTF_00398597; iTF_00464423; iTF_00433802; iTF_00901996; iTF_01021986; iTF_00423504; iTF_01515250; iTF_01284019; iTF_01286964; iTF_01185941; iTF_00752706; iTF_01126115; iTF_01370762; iTF_00260407; iTF_00248694; iTF_01283069;
- 80% Identity
- -