Zces012164.1
Basic Information
- Insect
- Zerene cesonia
- Gene Symbol
- Ssb-c31a
- Assembly
- GCA_012273895.1
- Location
- CM022621.1:3432237-3433100[+]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.7e-29 9.2e-25 85.8 0.6 1 51 44 94 44 95 0.96
Sequence Information
- Coding Sequence
- ATGCCAAagaataagaaacaaaaagaCGATAGTTCAAGTAGCGACAGTGATGAAGGTCCAGTAGAtaggAATCCTCCGCCAGAAAAGAAGGCAAAAACCAGTTCAAGGACGGATGACAAAGAACCTACTTGGGTGCTTCAGGGCAAAAAATTAGTTAAAGTGAGAGAATTTAAGGGAAAAGTATATGTTGATATCAGAGaattttatgagaaaaatGGTGAACTTTTACCTGGCAAGAAAGGTATTTCTTTACCTCCTGACCAGTGGAGGAAGTTATTGTCCTTAGGCgatgaaataaatgatacaATCAGTTCCATGTGCTAA
- Protein Sequence
- MPKNKKQKDDSSSSDSDEGPVDRNPPPEKKAKTSSRTDDKEPTWVLQGKKLVKVREFKGKVYVDIREFYEKNGELLPGKKGISLPPDQWRKLLSLGDEINDTISSMC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01076532;
- 90% Identity
- iTF_00357538; iTF_01193617; iTF_01205729; iTF_00114978; iTF_00358594; iTF_01204067; iTF_01203268; iTF_00771112; iTF_00711051; iTF_01206578; iTF_01202494; iTF_01204926; iTF_00710239; iTF_00878880;
- 80% Identity
- -