Zhep016567.1
Basic Information
- Insect
- Zelleria hepariella
- Gene Symbol
- -
- Assembly
- GCA_949319315.1
- Location
- OX439390.1:11420977-11421673[+]
Transcription Factor Domain
- TF Family
- HMGA
- Domain
- HMGA domain
- PFAM
- AnimalTFDB
- TF Group
- Unclassified Structure
- Description
- This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.013 1.6e+02 2.5 3.2 11 16 13 18 11 19 0.82 2 4 2.9e-10 3.5e-06 27.0 1.9 4 21 53 70 51 71 0.90 3 4 0.28 3.3e+03 -1.7 4.9 10 15 82 87 80 88 0.85 4 4 1.2 1.4e+04 -3.7 1.7 4 9 90 95 89 96 0.77
Sequence Information
- Coding Sequence
- ATGTCTGACGATGGCAATGTAGTCGTTGAGAAGAAAGGTAGAGGCAGACCTAAATCCAACGGCACACAAGCTGAAGCGAAAGCTGATACTAAGAAACGAGGAAGGCAAGCGGCACCTGCTAAGGTCAAGGAATCTGCAAAGTCCTCTGATGATGAACAAGCGCCAGCAGCGAAACGAGGGCGCGGCAGACCGAAGGGTTCCAAGAAAAAGGCTGCACCTAAGGCAAAGGCACCAGTAGAGGGCAGAGGCCGCGGCCGACCCCGCAAGGAAGCCCCTCCCCCCAAAAAAGATGCCACTTCTGAGGAGGATCAGGAGGAAGATGAAGAGGATGAGGGATCCGACCAGTAA
- Protein Sequence
- MSDDGNVVVEKKGRGRPKSNGTQAEAKADTKKRGRQAAPAKVKESAKSSDDEQAPAAKRGRGRPKGSKKKAAPKAKAPVEGRGRGRPRKEAPPPKKDATSEEDQEEDEEDEGSDQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01115716;
- 90% Identity
- iTF_01561138;
- 80% Identity
- iTF_01561138;