Ypad022750.1
Basic Information
- Insect
- Yponomeuta padella
- Gene Symbol
- FTZ-F1
- Assembly
- GCA_947311075.1
- Location
- OX371229.1:20019530-20024349[+]
Transcription Factor Domain
- TF Family
- SF-like
- Domain
- zf-C4|SF-like
- PFAM
- AnimalTFDB
- TF Group
- Zinc-Coordinating Group
- Description
- The ligand binding domain of nuclear receptor steroidogenic factor 1 (SF-1): SF-1, a member of the nuclear hormone receptor superfamily, is an essential regulator of endocrine development and function and is considered a master regulator of reproduction. Most nuclear receptors function as homodimer or heterodimers, however SF-1 binds to its target genes as a monomer, recognizing the variations of the DNA sequence motif, T/CCA AGGTCA. SF-1 functions cooperatively with other transcription factors to modulate gene expression. Phospholipids have been determined as potential ligands of SF-1. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, SF-1 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). [1, 8, 3, 11, 6, 5, 12, 10, 9, 2, 4, 7]
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 6e-49 5.1e-45 155.1 0.1 243 408 1 163 1 165 0.98
Sequence Information
- Coding Sequence
- ATGAAACTGCTACAACACTCGTGGTCCGACATGTTAGTGCTAGATCACCTCCACCAGAGGATGCACAATGGCCTCCCTGACGAGACCACACTACACAATGGGCAGAAGTTTGACCTACTCTGCCTTGGCCTCCTGGGAGTCCCCGCCCTGGCCGAACACTTTAATGAGCTCCAGAATAAACTGGCGGAACTCAAATTCGATGTTCCCGACTACATCTGCGTGAAATTCTTGCTTCTTCTCAATCCAGACGTGAGAGGCATCGTGAACGTCAAGTGTGTCCGCGACGGCTACCAGACGGTACAAGCCGCGCTCCTTGACTACACCCTCACGTGCTATCCTACGATACAGGATAAATTCGGCAAGCTGGTGACAGTGGTTCCGGAGATACACGCGCTCGCGGCGCGCGGGGAGGAGCACCTGTACCAACGGCACTGCGCGGGCCAGGCGCCCACGCAGACCCTCCTCATGGAAATGCTCCACGCTAAACGCAAGCCGAACGGCGGCGAGATGGTCAGCCGAACTGCCGACCACAACTCCACACTAGACAGATTTGTGTGGTCTCTGATTTCAGATCTTGAAGTCCCTGTGAAGAATGAGCTCGCGAACTGCTAA
- Protein Sequence
- MKLLQHSWSDMLVLDHLHQRMHNGLPDETTLHNGQKFDLLCLGLLGVPALAEHFNELQNKLAELKFDVPDYICVKFLLLLNPDVRGIVNVKCVRDGYQTVQAALLDYTLTCYPTIQDKFGKLVTVVPEIHALAARGEEHLYQRHCAGQAPTQTLLMEMLHAKRKPNGGEMVSRTADHNSTLDRFVWSLISDLEVPVKNELANC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00783544;
- 90% Identity
- iTF_00942882; iTF_01529250; iTF_00737539; iTF_00675205; iTF_01125574; iTF_00752135; iTF_00032969; iTF_00033865; iTF_01401354; iTF_00207052; iTF_00926668; iTF_00994413; iTF_01544045; iTF_00675182; iTF_00353136; iTF_00674352; iTF_00737585; iTF_00111730; iTF_01125523; iTF_01401395; iTF_01543028; iTF_01544980; iTF_00791253; iTF_01543061; iTF_01546711; iTF_00063704; iTF_01529304; iTF_01543994; iTF_01561211; iTF_00013084; iTF_01546748; iTF_00341437; iTF_01561181; iTF_00013182; iTF_00751262; iTF_01091998; iTF_00341376; iTF_00913715; iTF_00913665; iTF_00666591;
- 80% Identity
- iTF_01544045;