Xsyl020502.1
Basic Information
- Insect
- Xylota sylvarum
- Gene Symbol
- -
- Assembly
- GCA_905220385.1
- Location
- LR999959.1:83168442-83168899[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.8e-27 4.7e-24 84.9 11.3 2 70 59 128 58 128 0.96
Sequence Information
- Coding Sequence
- ATGAGTAAAGCCCCAGGACCGACTCCACCCCAGTACACGTATGTACCACCACCATCGGCTCCGCCAAGCTATCAGGAGGCTGTAGGTGGTGTCAAACCCACTAGTCCATTCACTCCGATTGTTCAACCAGTCACCAATACAACCATTCTGACAACAGTCGTTCCAATTGGTCGCACTGCAACGCATATGATCTGTCCATCGTGCAATGCCGAAATCGAAACGACCACGCGTACCGAACCGGGCTTGATTGCATATCTATCTGGATTTGTTATTGCTTTACTAGGCTGCTGGCTAGGTTGCTGTCTCATTCCATGCTGCATTGACGAATGTATGGACGTACATCACACTTGTCCCAATTGCAAGGCATATCTTGGACGTTATCGGCGATAA
- Protein Sequence
- MSKAPGPTPPQYTYVPPPSAPPSYQEAVGGVKPTSPFTPIVQPVTNTTILTTVVPIGRTATHMICPSCNAEIETTTRTEPGLIAYLSGFVIALLGCWLGCCLIPCCIDECMDVHHTCPNCKAYLGRYRR*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00455599;
- 90% Identity
- iTF_01541826; iTF_00976995; iTF_00894436; iTF_00241221; iTF_00689093; iTF_00426790; iTF_00992230; iTF_01318694; iTF_01523046; iTF_00335528; iTF_01301320; iTF_00188650; iTF_00975274; iTF_00313932; iTF_01223884; iTF_00313933; iTF_01254477; iTF_00311470; iTF_01522254; iTF_00665295; iTF_00673167; iTF_00664528; iTF_00390033; iTF_01045137; iTF_00427762; iTF_00984690; iTF_00310675; iTF_01003219; iTF_00315604; iTF_01521559; iTF_00313113; iTF_01300473; iTF_00694266; iTF_01212442; iTF_00312252; iTF_00666172; iTF_00695132; iTF_00725180; iTF_01116828; iTF_01396157; iTF_00314814; iTF_00316446; iTF_01357598; iTF_01396992; iTF_00672545; iTF_00671884; iTF_00671282; iTF_00672543; iTF_01051602;
- 80% Identity
- -