Xate009571.1
Basic Information
- Insect
- Xylophagus ater
- Gene Symbol
- -
- Assembly
- GCA_963422695.1
- Location
- OY730480.1:4758975-4767255[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.11 9.5e+02 0.9 0.0 26 45 41 60 32 66 0.84 2 5 0.00029 2.4 9.2 0.2 23 44 66 87 60 91 0.87 3 5 3.6e-06 0.03 15.3 0.0 20 48 91 118 87 123 0.85 4 5 0.0014 11 7.0 0.1 21 52 120 151 118 153 0.90 5 5 0.0025 21 6.2 0.3 20 48 147 174 146 178 0.86
Sequence Information
- Coding Sequence
- ATGAAACGAAATGTTGGCAACCAAGGAGGCAACATCACTTTCGAGgcATTTGCAACGAAACGTGATTcattattacataaaaaaactGTCCATGATAGTAATCCAgatcaaaataaattcatatgtGAAATATGTAATAAAGGTTTTGCAAATCATGGTAATATGTATCGTCATTTAAGAAGTCACGGTGACGTACGACCGCATACATGTAATCTTTGTGGTAAATCATTTGCACAAGCTGCAAATTTACAACGTCATCATTCTGTACATAATGGTGAACGGCCATTCACGTGTGGTGTATGTAATAAAGGTTTTACCCAGCAAGGTAATTTAAGACGTCACGAATTAATACATACCGGTGAAAAACCGTTTCGTTGTAAACGTTGCGGTCGTATGTTTTCACAACGTGTTAATCTAAAAAAGCATGTAATGCTACATCAAGGCTATAAACCGTTTGTATGCGAAATATGTAATCGTTCGTttttacaaaatcaaaattatcaaaaacatatGCAACGACATTCAGAAAAGGATATTAAATCGGAAAATATGATTCAaTATTATGAATGCGCAATGTGTGGTGTAAGTTTTAGTGATTTTGCTGATTTTGAATCACATGAAATCTTTTGTGAAGTCGCTGGTGAAGAACAAATTGAAACGACAGTTGTATCGCAACAGCattttcgaacgatgataacaAAATCATCATCAACACCGCCGCCGCCGCTGCCACTACCATCACGACCAGAGGACACACTGCATCAAATTCAACAAGAAACAGCTCTAATAACGATAATAAATAAagatatttcataa
- Protein Sequence
- MKRNVGNQGGNITFEAFATKRDSLLHKKTVHDSNPDQNKFICEICNKGFANHGNMYRHLRSHGDVRPHTCNLCGKSFAQAANLQRHHSVHNGERPFTCGVCNKGFTQQGNLRRHELIHTGEKPFRCKRCGRMFSQRVNLKKHVMLHQGYKPFVCEICNRSFLQNQNYQKHMQRHSEKDIKSENMIQYYECAMCGVSFSDFADFESHEIFCEVAGEEQIETTVVSQQHFRTMITKSSSTPPPPLPLPSRPEDTLHQIQQETALITIINKDIS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01540858;
- 90% Identity
- iTF_01540858;
- 80% Identity
- iTF_01540858;