Xruf007407.1
Basic Information
- Insect
- Xestobium rufovillosum
- Gene Symbol
- -
- Assembly
- GCA_963966045.2
- Location
- OZ014493.1:14606167-14606604[+]
Transcription Factor Domain
- TF Family
- PAX
- Domain
- PAX domain
- PFAM
- PF00292
- TF Group
- Helix-turn-helix
- Description
- The paired domain, a ~126 amino acid DNA-binding domain, is found in eukaryotic transcription regulatory proteins involved in embryogenesis. Initially identified in Drosophila’s paired (prd) protein, it typically resides in the N-terminal region and may be followed by an octapeptide, a homeodomain, or a Pro-Ser-Thr-rich C terminus. Paired domain proteins act as transcription repressors or activators, with DNA-binding specificity mediated by three subdomains. Crystal structures reveal a bipartite DNA-binding paired domain: an N-terminal subdomain (PAI) and a C-terminal subdomain (RED), linked by a flexible linker. Both subdomains contain a helix-turn-helix motif that binds DNA's major groove, while the linker may bind the minor groove. Variations in domain usage across Pax proteins and isoforms determine sequence specificity.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 8.1e-08 6.2e-05 24.5 0.0 28 110 16 97 9 108 0.85 2 2 9.8 7.4e+03 -1.6 0.0 30 46 114 130 94 133 0.67
Sequence Information
- Coding Sequence
- atgcCTTACAATCGTTTAAGCGTAGATAATTTGAATACAGCTTTGCGTCTTATCCAAAATGGCGCTTCACAAAGAGAAATTGCTAGATTTTTTAATGTTTCGCATAGCGTACTAAGCAGAGCTCATCAACGACTTCAAACTACTGGAAGTGTTGCTTTCCGGCATGGCGGAGGTCGCCAAAGAAGTCTTACACCAGCGCAGGCACATTATGTGCGCTTAACCGCTAGGCGAAATCCCACTCATACGTCAACTCAAATTAATAATGAGCTTCACGATGCTGCTGGAATTGATGTTTCCACTCGAACCATCAGAAGAATGTTGAATGAGTCCAATTTAAGAGCTAGAAGGCATGCGACATGTTGCTTGCTTACTAGGCAGCATCGCGTTGCCCGAAGAATTTGGGCTGAAGAACATATAAACTGGGGCAATGAAGAATAG
- Protein Sequence
- MPYNRLSVDNLNTALRLIQNGASQREIARFFNVSHSVLSRAHQRLQTTGSVAFRHGGGRQRSLTPAQAHYVRLTARRNPTHTSTQINNELHDAAGIDVSTRTIRRMLNESNLRARRHATCCLLTRQHRVARRIWAEEHINWGNEE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01536148;
- 90% Identity
- iTF_01536148;
- 80% Identity
- iTF_01535992;